KEGG   Aspergillus oryzae: AOR_1_1296174Help
Entry
AOR_1_1296174     CDS       T01018                                 

Gene name
AO090005000739
Definition
glutathione peroxidase Hyr1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aor  Aspergillus oryzae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aor00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:aor00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 256 aa AA seqDB search
MRSTLSSASIVLRALSSQKPLIYFLAHITSPVAKSPRRSSSTLSSSAKLLLNHQQPRLSA
FHTHTMASATTFFDFEPVDKKGSPFPLTPLKGKTILVVNTASKCGFTPQFEGLEKLYQKL
KSKYPEDFTILGFPCNQFGGQDPGSNDQIQDFCQLNYGVTFPVLGKLDVNGNEASPLWTW
MKEQQPGLLGLKRVKWNFEKFLISPDGKVVGRWASTTKPESLEDTIVKEIEKAQKAGTAA
SVQAKEGESAEQAKLS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcaaccctatcgtctgcgtctatcgtcctacgtgctttatcatcccagaaacca
ttaatctacttcctcgcgcatataaccagccctgtcgcaaaatcgccgcgcaggtcttct
tcaacgctgtcaagctccgctaagctgctactcaatcatcaacaacctcgtttgagcgca
tttcatacgcacaccatggcttccgcaaccaccttcttcgactttgagccagttgacaag
aaaggctctccttttcccctcaccccgctcaagggcaagaccatcctcgtcgtcaacact
gcctccaagtgcggctttactccccagttcgaaggtctcgagaaactctaccagaagctg
aagtccaagtaccccgaagactttactatcctcggattcccttgcaaccagttcggcggc
caggatcccggttccaacgatcagattcaagacttctgccagctgaactacggtgttaca
ttccctgtgttgggcaagctggatgtgaacggaaacgaggcctcacccttgtggacctgg
atgaaggagcagcaacccggtctgctgggcctgaagcgcgtcaagtggaacttcgaaaag
ttcctgatctcgcccgatggcaaggtcgtcggtcgctgggccagtaccaccaagcccgag
tcactcgaggacaccatcgtcaaggagattgagaaggcacagaaggccggaactgcagct
tcggttcaggctaaggagggagagtctgctgagcaggctaagttgtcgtaa

DBGET integrated database retrieval system