KEGG   Aspergillus oryzae: AOR_1_1296174Help
Entry
AOR_1_1296174     CDS       T01018                                 

Gene name
AO090005000739
Definition
glutathione peroxidase Hyr1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aor  Aspergillus oryzae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AOR_1_1296174 (AO090005000739)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AOR_1_1296174 (AO090005000739)
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AOR_1_1296174 (AO090005000739)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 256 aa AA seqDB search
MRSTLSSASIVLRALSSQKPLIYFLAHITSPVAKSPRRSSSTLSSSAKLLLNHQQPRLSA
FHTHTMASATTFFDFEPVDKKGSPFPLTPLKGKTILVVNTASKCGFTPQFEGLEKLYQKL
KSKYPEDFTILGFPCNQFGGQDPGSNDQIQDFCQLNYGVTFPVLGKLDVNGNEASPLWTW
MKEQQPGLLGLKRVKWNFEKFLISPDGKVVGRWASTTKPESLEDTIVKEIEKAQKAGTAA
SVQAKEGESAEQAKLS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcaaccctatcgtctgcgtctatcgtcctacgtgctttatcatcccagaaacca
ttaatctacttcctcgcgcatataaccagccctgtcgcaaaatcgccgcgcaggtcttct
tcaacgctgtcaagctccgctaagctgctactcaatcatcaacaacctcgtttgagcgca
tttcatacgcacaccatggcttccgcaaccaccttcttcgactttgagccagttgacaag
aaaggctctccttttcccctcaccccgctcaagggcaagaccatcctcgtcgtcaacact
gcctccaagtgcggctttactccccagttcgaaggtctcgagaaactctaccagaagctg
aagtccaagtaccccgaagactttactatcctcggattcccttgcaaccagttcggcggc
caggatcccggttccaacgatcagattcaagacttctgccagctgaactacggtgttaca
ttccctgtgttgggcaagctggatgtgaacggaaacgaggcctcacccttgtggacctgg
atgaaggagcagcaacccggtctgctgggcctgaagcgcgtcaagtggaacttcgaaaag
ttcctgatctcgcccgatggcaaggtcgtcggtcgctgggccagtaccaccaagcccgag
tcactcgaggacaccatcgtcaaggagattgagaaggcacagaaggccggaactgcagct
tcggttcaggctaaggagggagagtctgctgagcaggctaagttgtcgtaa

DBGET integrated database retrieval system