KEGG   Aspergillus oryzae: AOR_1_1298174Help
Entry
AOR_1_1298174     CDS       T01018                                 

Gene name
AO090005000740
Definition
beta-mannosidase B
Orthology
K01192  
beta-mannosidase [EC:3.2.1.25]
Organism
aor  Aspergillus oryzae
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aor00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 843 aa AA seqDB search
MSGFKSLELSQGWQFRDASDSSPEAWRSVSNVPTVVHLDLIEQGVIPDPFIGMNELQVQW
VGERDWIYRVEFVPPKLDAGQRCDLLFEGLDTIATVKLNGELILKSDNMFIPHRVDITKH
LMPKSSSVMTLDILFESALLCGRERVKQHPEHRFITHQTEAGRSSVRKAGYHWGWDWGPI
LMTAGPWRPVRLETYTARVEDVWVESEVSQDLNLCRGRLKAQVSGRSGNCVHFKILLRNK
VLFESEVSATGDDYAETEFVIQNPALWYPRGYGRQDLHEICVKLIDNHEVQHEVSKLTGF
RSVELVQEKDQHGQSFFFRINGIDTFAGGSCWIPGDSFLPRLTPDKYRQWLGLLLEGNQN
MIRIWGGGIFEPSAFYSICDELGILVWQDFMFACASYPTYPSFLSSIEEEARVNVKRLRH
HPSIVIYAGSNEDYQIQEKYHLDYNFETDKDPQSWLKSTFPARYIYEYLLPKVVEEESPT
TPYHPTSPWGGGKHSADPTIGDIHQWNIWHGSMLPYQNFPEVGGRFVSEFGMEAFPHRAT
IEQFIEDEDEMYPQSLTMDFHNKARDHERRLGTYILENFRIKSDFQAYIHLSQVVQSDAM
KFAYQGWRRQWGHGRLCGGALVWQLNDCWPTTSWAVVDYYLRKKPAFYVISRALEPIAVG
VSRAHEEWTSGHAKPAESTRYELWAVTSHLKPICATLSLRCISIRTGADVQPEVSHEVVL
VPNGTTEVASEEMSLKEADAFVLTATLSIDGRVISRDMDWPQPYKYLSFRDRGVEVKHLP
AENALSITARKPVKGLVFEEADGVWLQDNGIDIVPGYEHIIAVRGIHSSSDIPRWTYIGD
DRL
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcttcaagtcgctcgagctctcgcaaggctggcaattccgggacgccagcgat
agcagtccagaggcatggcgtagcgtttccaatgtcccaaccgttgtacacctcgatctc
attgagcaaggtgtgatacccgacccgttcatcgggatgaatgagctccaagtgcagtgg
gttggtgagcgagactggatatatcgggtggagttcgtgccaccaaagcttgatgccggt
caacgatgtgatctcctcttcgaaggcctagatactatcgcgactgtcaagttgaacggt
gaactcattctaaagagcgataatatgtttatcccccatcgagttgatatcacgaaacat
ttgatgccgaagtctagcagcgtcatgacgctcgatatcttgtttgagtctgctctgtta
tgtggacgggagcgggttaagcaacatcctgagcaccggttcattacacatcaaacggaa
gctgggcggagctcggtccgaaaggctgggtatcattggggctgggactggggtcctatt
ttgatgacggctgggccgtggagaccagttcgattggagacctatacagctagggttgaa
gacgtatgggttgagagcgaagtaagccaggatttgaatttatgtcggggtcgtctcaag
gcgcaagtttctgggaggtcaggaaattgtgttcatttcaagattctgctccggaataag
gtgctttttgagtctgaagtaagtgctacaggggatgattatgcagagacagaattcgtg
atccaaaatccagcattatggtatccgcgtggatatggccggcaggacctacatgaaatc
tgtgtcaagctcattgacaatcatgaggtgcaacatgaggtctccaagttgaccgggttc
agaagtgtagagcttgttcaagagaaagaccaacacggccaatccttctttttcaggatt
aatggtattgacacttttgccggcggctcatgctggataccgggcgatagcttccttcct
cgattgacccctgacaagtacaggcaatggctcggattgctgctagagggaaatcagaat
atgattcgcatctggggtggcgggatctttgagccctccgccttttactccatttgtgat
gagctcgggattttagtctggcaagattttatgtttgcatgcgcctcgtatcctacctat
ccttcctttttgtcgtccatcgaggaagaagcgcgtgtaaatgtcaaacgtcttcgtcat
catccctccatcgtgatctacgcaggaagtaacgaagactaccagattcaagaaaaatac
catcttgactataacttcgagactgataaagacccgcagtcatggcttaagtcaaccttt
cctgccaggtacatctatgagtacctattgccgaaggttgtagaggaagaatcacccact
acaccataccacccaacaagcccgtggggaggaggaaagcattcagcagatccaacaata
ggagatatccatcagtggaacatctggcacggatcaatgttgccttatcaaaactttccg
gaagttggcggacggttcgtcagtgaattcggaatggaagcgttcccgcatcgagcgaca
atcgagcagtttattgaagatgaagacgagatgtaccctcaatctctcaccatggacttt
cacaacaaagccagagaccacgagcgacgactcggcacttatatcctcgagaacttccgg
atcaaatcagattttcaggcatacatacatctctctcaggttgtacaatccgacgctatg
aagtttgcgtatcagggctggcgccgacaatggggccacggccgcctctgtggtggagcc
ttggtttggcaactaaatgactgttggccgacgacctcgtgggcagtggtagactattat
ctgcgaaagaagcccgcattctatgtcatatcgcgggctctggaaccaattgcagttggt
gtttccagggctcacgaggaatggacatctggacatgccaagcctgcagagtcaacgaga
tatgagctttgggctgtgaccagccatcttaagccgatctgcgctacgttaagcttacgc
tgcatatcaatccgaacgggtgcagatgtgcagccagaggtatcacacgaggttgttctc
gttccaaacggtacaacggaagtagcaagcgaggagatgagtttaaaagaggcggatgca
tttgtgctgaccgcaaccctgagtattgatggtcgggtaattagtcgagatatggattgg
ccacagccttacaagtacctctcattccgagacaggggtgtagaggtcaaacatcttcct
gcagaaaatgcgttgtccatcacagccagaaagccagtcaagggtttggtctttgaggag
gcagatggcgtttggctgcaagataacggaatcgacatagtccctggctatgagcacatt
attgccgtccgtggaatccacagttcctctgatatcccacgttggacatacattggggat
gacagactatga

DBGET integrated database retrieval system