KEGG   Aspergillus oryzae: AOR_1_1308154Help
Entry
AOR_1_1308154     CDS       T01018                                 

Gene name
AO090003000741
Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aor  Aspergillus oryzae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AOR_1_1308154 (AO090003000741)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AOR_1_1308154 (AO090003000741)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AOR_1_1308154 (AO090003000741)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 867 aa AA seqDB search
MQSTDLRKKVGQLFAVGFHGLTPSPEIKTLIHEYGLGGIVLFKRNISDAAQLQSLTHSLQ
EEARLAGHDYPLFIGIDQENGLVTRISPPIAAQLPGPMALGATYASELAKEVGTVTGETL
RLFGINMNYAPVCDINSEPLNPVIGVRSFGDHPGLVGRLACATAQGLREQKVVPSVKHFP
GHGDTAVDSHYGLPVISKTREQLDKCELRPFRRAIAEGIEAVMTAHISLPSVDDSHLPAT
LSAKALNILRKDMNYDGMVITDCLEMDGIRASYGTEQGAVLALGAGCDSIMVCHTYDVQV
GSIDKICEAVESGKVPTSRLEEACRRVTALKARFLSWDAALKSQGLNGLTSLKQKGAKLA
KEAYSSSVTLVRDTQSILPLSPSSKIAFLFPGDKTPAGGAVDGEGLGRKGSYNASIYLDI
LKQWNNQAFEIQYGPMGLSTEQLSLVDAADVVIFASINARESAYQRTLGLELPRHNRPMV
AMALCNPYDFLEDSFIQTYVATYEPTIEAFTVAVELLFRPHLAKGSLPVGPEKPAPRWLE
VQQYAAATDFSQVYDVWLAALPSYRVSADNLTEAITPPPHVLPVESHHLVARTSYPESKV
VGFCLLFVAAQQDTVCVQLAALAVDPKLQGRGVGTALLAECRAWMEKTFKKSRLELGSTF
PRFWPGLPIDLPTEVQEFFVHRGFQLNPPVPRSVDLYQDIKEFQSPELYVTRAKERGYTF
RPLETADYQECLVGQEKNFSYNQAWVQMFHKLDPSKYPSSVMTAFDPNGKQVGWTLMLSH
ESPMLKPHWAFPSLCGPKTGLIGCVGVDADYRKEGVGLALLCHAIEDMKQRGVEGVFVDW
VSLEGWYEKLGFKVWWSCRTGAMQLDA
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccacagatctgcgcaagaaagtcggccagctttttgcggtcggctttcacggc
ctcactcccagccccgagattaaaaccctaatccacgaatatggtttggggggcattgtc
cttttcaaacgaaacatcagcgatgcagcccagttgcaatctttaactcactctttacaa
gaagaagcgaggctagctgggcatgattatcccttatttatcggtattgaccaagagaat
ggattggtcactcggatttcacctcctattgccgctcaactcccggggcctatggctctc
ggagcgacctatgcctcggagcttgctaaggaagtcggcaccgtcacgggcgagacgctg
agactatttgggatcaacatgaactatgctcctgtgtgcgacattaactcagaaccccta
aacccagtgatcggagtccgcagttttggagaccatcctggattggtgggaagattggca
tgcgccactgcccaaggactccgagaacaaaaggtggtacccagcgtcaagcatttccca
gggcacggagacactgctgtggactcccattatggccttcctgtcatctctaagacgaga
gaacagctagataaatgtgaattgagaccatttcgcagagctatagctgaaggtattgag
gcagtgatgactgcccacatttcgctaccttctgttgacgatagtcatctccctgctaca
ctttctgctaaagccttgaatatactacggaaggatatgaactacgatggcatggtgatc
acagactgtctagagatggatggtatccgtgcctcatacggtactgagcagggggcagtc
ctcgctttaggagctggctgtgacagcattatggtctgtcacacttatgatgtccaggta
ggatctatcgacaagatctgcgaggctgtagaatccggaaaggtgccaacttcgcgtctg
gaggaagcttgtcgcagagtgactgcactaaaagcccgttttctgagttgggacgcagcg
ctcaagtcacagggccttaatgggcttacgtctcttaagcaaaagggcgcaaagttagcg
aaagaagcctattctagctcggtcactcttgtgcgcgatacacagagtatccttcccctc
tctccttcgtcgaagattgcatttctctttccgggtgacaagacaccggctggcggtgca
gtggatggggaaggtttgggcagaaagggatcgtataatgcctccatttatctcgatatt
cttaaacaatggaataaccaagccttcgagattcaatacgggccaatgggtctatcgact
gagcagcttagtcttgtcgacgctgcagatgtggtcatattcgcgtctatcaatgcacgg
gaatcggcatatcaaagaacgttgggtctcgaactgccgcgccacaatcgtccaatggtt
gctatggcactctgtaatccttatgactttctggaggattcatttattcagacctacgtc
gctacctacgagccaacgatagaggcttttacagtagctgtggagcttctctttaggccg
catctcgcaaaggggtctctacctgttgggccagaaaagcctgcaccacgttggcttgaa
gtacaacaatacgcagctgcaactgacttttcccaggtatatgatgtatggctcgcagcc
ctgcccagttacagagtatctgcagacaatttaactgaagcgataacgcctccgcctcat
gttcttccagtcgaatcacaccatctcgttgctaggacaagctacccggagtccaaagtc
gttggattttgcctcctcttcgtagccgcccagcaggatactgtctgtgtccaacttgca
gcacttgcggttgatccgaaattacagggtcggggagtggggactgccttacttgcagag
tgtcgggcttggatggagaaaacattcaagaaatcccgtctagaactgggaagcacattc
ccacgtttctggcctgggcttcccattgacctgccgacggaggtccaggaattctttgtc
catcggggattccagctaaaccccccagtcccgcggtctgttgatctctatcaagacatc
aaagaattccaaagcccagagctgtacgtcactcgagctaaggagcgaggttataccttc
cgtcctctagaaactgccgactaccaagaatgtcttgttggccaggagaagaacttctca
tataaccaagcctgggttcagatgttccataaacttgaccctagcaaatacccgtctagt
gtgatgaccgcatttgaccccaacgggaagcaagtgggctggacactaatgctttcccat
gagtctcctatgctcaagccgcattgggcattcccttctctctgtgggcccaagaccggc
ctcatcggttgtgtcggtgtcgacgcagattatcgcaaggagggagttgggcttgcctta
ctctgccatgcgatcgaagatatgaagcagagaggagttgaaggagtttttgttgactgg
gtgagcctcgaaggatggtatgagaagctcgggttcaaggtttggtggagttgccgaacg
ggggcgatgcaacttgacgcttga

DBGET integrated database retrieval system