KEGG   Aspergillus oryzae: AOR_1_1354164Help
Entry
AOR_1_1354164     CDS       T01018                                 

Gene name
AO090001000752
Definition
ubiquitin hydrolase
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AOR_1_1354164 (AO090001000752)
Peptidases [BR:aor01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AOR_1_1354164 (AO090001000752)
Exosome [BR:aor04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AOR_1_1354164 (AO090001000752)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 783 aa AA seqDB search
MASCVHVNSHDLKPPSLSQAVYREDCTQCFDSIDDEAGLNVCLTCFNGGCAGDRDHASLH
FKRHGHPLALNIKRIRKKVQRDEPPHKISKLAIAAETDENRYDTTTRVICYSCGKDEIDK
TSGGLAMTIDGVLNAMSFSKREEVKAWEQEFVPCEHTLCLNQQESRNIGSKDLSQCSMCD
LKENLWLCLECGNLGCGRSQFGGIGGNSHALAHADRTSHAIAVKLGSITADGSADIYCYK
CNEERTDPDLAVHLAHWGINLAGREKTEKSLMEMQVEHNLKWEFSMTSEDGHELSPIFGP
GFTGLANLGNSCYLSSVIQCLFDLPEFQQRYRHENEEPPLTDSPAEDLETQLRKLADGIL
SGRYSRADMDVIVAPDSPEVPRQKGLVPAMFKHLVGRGHEEFSTMKQQDAFEFLLHLFKL
INLSRHPDNLSSPTHSFMFAMEQRLQCVCCKKVRYKVDEQDNVSIPVPARRLALPDDTTS
TGQFAPVTLFDCLDASTSEEVVDLVCPSCGSKDGFSKRSSFRTLPQQLVINARRFELINW
VPTKLDIPVDVSEEPLDLSPYLSSGQKEGEELLPDIDASKRDFVPNQYALDQLLSMGFPR
ARSEKALYTTGNSDFEAAMNWLFAHLEDPDIDEPLTISEIRGGGTDASHDPAKVAQLVEM
GIDESRAKRALGATGGDVNRAIDWVFSHPEADAEGYGRESNTHSDGCPRNLGSSDVPARY
KLRSIVCHKGSSVHAGHYVAFVRKTLPGQNEPCWVMFNDEKVVKAGDIHEMKKYAYLYFF
SRV
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttgcgtgcatgtaaattctcacgatctaaagcccccatctctctcacaagct
gtataccgagaagattgcacacagtgttttgattccatcgacgatgaagccggtttgaat
gtttgcctcacttgcttcaatggcggctgcgctggggacagagatcatgcgtctctccat
ttcaagcgccatggccaccccttggcattgaacatcaaacgaattcgaaagaaggtccag
cgtgatgagcccccacacaaaatctcaaaacttgcaatagctgccgaaacagatgaaaac
cgctatgacacaaccacgcgcgttatctgttattcatgcggtaaagacgagattgataag
acgagtggtggactagcgatgaccattgatggagtcctaaatgcgatgtcattctcaaaa
cgagaggaggtaaaggcctgggagcaggagttcgttccttgtgaacacaccctctgcctg
aatcaacaggaatccagaaatatcgggtcgaaagacctgagtcaatgttccatgtgtgat
ctgaaggagaatctttggctttgcttggaatgtggcaatcttggctgcgggcgtagccaa
tttggtggtataggtggaaactctcacgcccttgcacacgcggaccgaacatcccatgcg
atcgccgtcaaacttggctcgataacggcagatggctctgctgacatctactgctacaaa
tgcaacgaagagaggactgacccagacctggctgttcaccttgctcactggggtattaac
ctagcggggcgtgagaaaacagagaaaagcctgatggagatgcaggttgaacataaccta
aaatgggaattttcaatgacgtctgaggatggccatgaacttagcccaatattcgggcca
gggtttactggtttagccaatctagggaatagctgctacctatcaagcgtcattcaatgc
ctattcgacttgccagaatttcaacagagatatcgccatgagaacgaagaaccaccgctc
acagattcccccgcggaggaccttgaaacgcaactgcgcaaactcgctgatggtatcctg
tcagggcgttactcgcgagctgatatggatgtcattgtcgcacccgactctccagaagtc
cctcgccagaaaggcctagtgccggcgatgtttaagcatcttgtcggtcgtgggcacgag
gaattctcgacaatgaaacagcaggatgcattcgaattcttactgcacctcttcaaactc
attaacttatctaggcatccagataatttaagcagccccacccactccttcatgttcgct
atggagcaacgtcttcaatgcgtgtgttgcaagaaggttcgctataaggtagatgagcag
gacaatgtttccatccctgtccctgctcgacgattagcactaccagacgacacaacttct
actggtcaatttgcaccggtgaccctctttgactgcctggacgcctccacgtcggaggag
gttgttgaccttgtctgcccttcttgtggcagcaaggatggattttccaagcgctcttcg
ttcaggacactaccgcagcaacttgtcatcaatgctcggcggtttgaattgattaactgg
gtacctaccaaattagatatcccagtggatgtgagcgaggagcctttggatttaagccca
tatctttcctctggacaaaaagagggcgaagagctcctgccagacatcgatgcttccaaa
agggattttgtgcctaaccaatatgctttggatcaacttctcagtatggggttcccgagg
gcaaggagtgagaaggcactctacacgactggaaactcggatttcgaagctgcaatgaac
tggttatttgctcatctggaagatcccgatattgatgaacccttgactatcagcgagatc
agggggggaggaaccgacgcctcacatgacccagcaaaagtggcacaattggtcgaaatg
ggcattgacgagtcccgtgccaaacgagcattgggtgccacaggtggtgatgtcaataga
gctatcgactgggtgtttagccacccagaagcagatgctgaaggctatggtcgtgaatca
aacacccattctgatggttgccctagaaacctcggttctagtgatgtaccagctaggtat
aagcttcgctctattgtctgccataagggttcttcagtccacgctggacattatgttgcc
tttgtccggaagactctgccaggtcagaatgaaccatgttgggtgatgttcaatgatgag
aaggttgtgaaggctggggacatacatgagatgaagaaatacgcatacttgtacttcttt
tcacgggtctag

DBGET integrated database retrieval system