KEGG   Aspergillus oryzae: AOR_1_1392144Help
Entry
AOR_1_1392144     CDS       T01018                                 

Gene name
AO090023000802
Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
aor  Aspergillus oryzae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aor00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AOR_1_1392144 (AO090023000802)
Exosome [BR:aor04147]
 Exosomal proteins
  Proteins found in most exosomes
   AOR_1_1392144 (AO090023000802)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1679 aa AA seqDB search
MAPLPIKFTELINLTNAEIAPASIGFNSCTLESDHYVCVRQKLNEEDKPQVIIINLKNNN
EILKRPINADSAIMHWTKNIIALKAQGRTIQIFDLGAKQKLKSAVMNEDVVYWKWFSDKC
LGLVTDSSVYHWDVFDPTQSQPLKIFDRLPNLSGCQIINYRVNDDEKWMVVVGISQQQGR
VVGSMQLYSKERGISQFIEGHAAAFASIRVEGSPLEHKLFTFAVRTQTGAKLQIAEIDHQ
DPNPRFQKKAVEVYFPQEAVNDFPVAMQVSRKYDVVYLVTKYGFIHLYDLETGTCIFMNR
ISSETIFTTAPDSDSAGLVGVNRKGQVLSVSVDENTIVQYLMENPAMSGLAVRLASKAGL
AGADHLYQQQFDNLLAQGNYSEAAKIAANSPRGFLRTPETINRFKNAPQTGQQMSVILQY
FGMLLDKGSLNKYESVELVRPVLQQNRKHLLEKWMREEKLEGSEELGDIVRPYDMNLALQ
IYLQANVPHKVIAGFAETGQFDKILAYSKQVGYQPDYTQLLQHIVRVNPEKGAEFAAQLA
NEESGALIDLDRVVDVFLSQNMIQQATSFLLDALKDNKPEHGHLQTRLLEMNLVNAPQVA
DAILGNEIFTHYDRPRISQLCENAGLIQRALENTDDPTAIKRNIVRTDKLSPEWLMNYFG
RLSVEQTLDCMDTMLQVNIRQNLQAVVQLATKFSDLLGPGSLISLFEKYRTAEGLYYYLG
SIVNLSEDPEVHFKYIEAATAMGQVTEVERICRESNYYNPEKVKNFLKEAKLTEQLPLII
VCDRFNFIHDLVLYLYQNQQYKSIEVYVQRVNPSRAPAVVGGLLDVDCEESIIKNLLSTV
DPAVIPIDELVNEVESRNRLKLLLPFLEATLATGNQQQAVYNALAKIYIDSNNDPEKFLK
ENDMYDTLTVGKYCEKRDPNLAYIAYRKGQNDLELINITNENAMYRAQARYLVERADPEI
WSFVLSENNVHRRSMVDQVIATAVPESTEPDKVSVAVKAFLEADLPGELIELLEKIILEP
SPFSDNGSLQNLLMLTAAKADKGRLMDYIHQLNEFSPDEIAEMCISVGLYEEAFEIYKKV
NNYIAAVNVLVENIVSIDRAQEFAERVELPDVWSKVAKAQLDGLRVSDSIESYIRASDPS
NYLEVIETATHAGKDEDLVKYLKMARKTLREPPIDTALAFAYARLDQLSELEDFLRSTNV
ADVETSGDKAYEEGYHEAAKIFYTSISNWAKLATTLVHLEDYQAAVECARKANSVKVWKQ
VNEACVNKKEFRLAQICGLNLIVHAEELQDLVRQYERNGYFDELISVLEAGLGLERAHMG
MFTELGIALSKYHPDRVMEHLKLFWSRINIPKMIRACEDANLWPELVFLYCHYDEWDNAA
LAMMERAADAWEHHSFKDIIVKVANLEIYYRALNFYLQEQPLLLTDLLQVLTARIDVNRV
VRIFQSSDNIPLIKPFLLNVQTQNKRAVNDAINDLLIEEEDYKTLRDSVDNYDNFDAVEL
AQRLEKHELIFFRQIAANIYRNNKRWEKSITLSKQDKLYKDAIETAALSGKAEVVEELLR
YFVDIGSRECYVGMLYACYDLIRPDVIMEVSWRHGLHDFTMPYMINFLCEQTRTIEMLKK
DNEERKKREVTQKTEEDNTPILGGSRLMLTQGPAAPVPSPMPYQQTNGITPQATGFRPF
NT seq 5040 nt NT seq  +upstreamnt  +downstreamnt
atggctcctctccccatcaagtttacggagcttattaatttgacaaatgctgaaattgcg
ccggcatctatcgggttcaactcatgtactctagaatcggatcactatgtctgcgttcgg
caaaagctcaatgaagaagataaacctcaagttatcatcatcaacttaaagaataacaat
gaaatcctcaaacggccaattaacgccgatagtgctatcatgcactggaccaaaaacatc
atcgctttgaaggctcaaggccgcacaatccaaatcttcgatcttggggcgaaacagaag
ctgaagtcagcggtgatgaatgaggatgttgtttactggaagtggttcagcgacaagtgc
ctgggtctggtaacggactcgtccgtttaccactgggatgtcttcgaccctacacagtct
cagccactcaagatcttcgaccgactccctaacttgagcgggtgccaaattatcaactat
cgcgttaacgatgatgagaaatggatggtagtagttggaatcagccagcagcaggggcgt
gttgtgggctcgatgcagctgtactctaaggaacgtgggatctcgcaattcatcgaagga
catgctgccgccttcgcttcgattcgagtcgagggttctcctttggaacataagctcttc
acctttgccgttcggacccagaccggtgccaagttacagatcgccgagattgaccaccaa
gatccgaacccccgattccagaagaaggctgtcgaggtgtatttccctcaagaggctgtc
aatgatttcccggtggcgatgcaagtatctcggaagtacgatgtcgtgtatcttgtcacc
aagtatggcttcattcatctctatgatctcgagactggcacctgcattttcatgaaccgg
atctccagcgagaccattttcactaccgcgcccgactcagattcggctggcttggttggt
gtgaaccgcaagggtcaggttctgtccgtcagcgttgatgagaacacgattgttcagtac
ttgatggagaaccctgctatgtctgggcttgcagtgaggcttgcctccaaggctggactt
gccggtgcggaccatctctaccagcaacagtttgacaacctccttgcccagggcaactac
tctgaggctgctaagatcgccgcaaactcgccccgcggattccttcgcactccggaaacc
atcaaccgcttcaagaatgctcctcaaaccgggcagcaaatgtctgttatcctccagtac
tttggaatgcttttggacaagggatctctgaacaaatacgagagtgttgagctcgtccgc
cccgtcttgcagcaaaaccggaagcacctccttgagaagtggatgcgtgaagaaaagctg
gagggctccgaggaacttggagatattgttcgaccctatgacatgaaccttgctctgcag
atttacttgcaagccaatgttcctcacaaggtcatcgctggctttgcagagactgggcaa
ttcgataagattctcgcgtactccaagcaggtcggttatcagcctgactatacccagctg
ttgcagcatattgtgcgtgtgaaccctgagaagggtgccgaatttgctgctcagctcgcc
aacgaggaatctggtgcactgatcgacctggatcgtgttgtggacgtattcttgtctcag
aacatgatccagcaggcgacttctttcttgttggatgccctcaaggataacaagcctgag
catggtcatctgcagacacggttacttgagatgaacctggtcaacgcccctcaagtggct
gatgctatccttggcaacgagatcttcacccactacgatcgcccaagaatttcccagctg
tgcgagaatgctggcctcatccaacgcgccctggagaacactgatgatcctacagccatc
aagcgtaacatcgtccgcaccgacaagctgagccctgaatggttgatgaattacttcggt
cgtctttctgttgagcagactctcgactgcatggatacgatgttgcaggtgaacatccgt
cagaatttgcaagccgtcgttcagcttgccaccaagttctccgatctcctgggtcctggt
agcctcatcagccttttcgagaagtaccgtactgctgaaggtctttactactaccttgga
agcatcgttaaccttagcgaggaccccgaggttcacttcaagtacatcgaagctgctact
gccatgggccaggtcactgaggttgagcgtatttgccgtgagagcaactactacaacccc
gaaaaggtgaagaacttcctaaaggaggccaagttgacggaacagctcccactgatcatt
gtctgcgatcgattcaactttatccacgacctcgttctctatctctaccagaaccagcag
tacaagtctattgaggtctacgtacagcgtgtcaacccttcccgtgctccggcagtggtt
ggagggttactggacgttgattgcgaagagagcattatcaagaaccttctctctacggta
gatccagccgttatcccgattgatgagcttgtcaacgaggtggagagtcggaataggctc
aagctgctcttgcctttcctcgaggctactctcgccaccggtaatcagcaacaggctgtg
tacaatgctcttgcgaagatctatatcgatagcaataacgaccccgagaagttcctcaag
gagaacgatatgtatgacacactgactgtcggcaagtactgtgagaagcgcgacccgaac
ctggcctatatcgcgtataggaaaggtcaaaatgacttggagctcatcaacatcaccaac
gagaacgccatgtatcgtgcccaggcacgctacctcgttgagagggctgatccggaaatc
tggtccttcgtcttgagtgaaaacaatgttcaccgtaggtccatggttgaccaggtcatc
gcaactgcagtgcctgaatcgacggaacctgacaaggtgtctgttgctgttaaggccttc
cttgaagccgacctgcctggcgagcttatcgagctgctagagaagattatccttgagcca
tcacctttcagtgacaatggcagcttgcagaacctgcttatgctcaccgctgccaaggct
gacaagggccgcctgatggactatattcatcagctcaacgaattcagccctgatgaaatt
gcggaaatgtgtatctcggttggcttgtatgaggaggctttcgaaatttacaagaaggtc
aacaactacattgccgccgtcaatgtccttgttgagaacattgttagcattgatcgtgcc
caagagtttgctgagcgtgttgagttgccggatgtatggagcaaggttgccaaggcacaa
ctagacggtcttcgtgtgtctgactcgatcgagtcgtacatccgtgctagtgacccttcg
aactaccttgaggtcattgaaaccgcaacccacgctggcaaggatgaggatctcgttaag
tatctcaagatggcacgcaagactttgcgggagccccctattgacactgctttggccttc
gcctacgccagactcgatcaactctcagaacttgaggacttcttgcggtcgaccaatgtt
gcggatgttgagacatctggtgacaaggcctacgaggaaggctaccatgaagctgccaag
atcttctacactagcatctcgaactgggccaagcttgccacaaccttggtacacttggaa
gactaccaagctgcggtggaatgtgcccgcaaggccaacagtgtcaaggtctggaagcag
gtcaacgaagcatgcgtcaacaagaaggagttccgtcttgcccagatctgtggtctcaat
ctcatcgtccatgctgaggagctgcaggatcttgttcgccaatacgaacgcaacggttac
ttcgatgaacttatctctgttctggaggctggcttgggcttggagagggcccacatgggt
atgttcactgagttgggtattgcgctctccaagtaccaccctgatcgggtcatggagcac
ctcaaactcttctggtcccgtatcaatatccccaagatgatccgggcttgcgaggatgcc
aacctctggccagagctggtgttcttgtactgccactatgatgagtgggataacgccgca
ttggcaatgatggagcgtgctgccgacgcttgggaacatcactcattcaaggatatcatc
gtcaaggtcgctaatcttgagatttactatcgtgctctcaacttctacctgcaagagcag
cctctgcttcttaccgatctgctccaggttttgaccgccaggattgacgtcaatcgtgtt
gttcgcattttccagtcctcagataacatacccttgatcaagcccttcctcctgaacgtc
cagacccaaaacaagagggcagtgaacgatgccatcaatgacctcttgatcgaggaggaa
gattacaagaccctgcgcgactcagtggacaactacgataacttcgacgccgtggaactg
gctcagcgtctggagaagcacgaactgatcttcttccgtcagattgctgcgaacatctac
cgcaataataagcgttgggagaagtcgattacactttcgaagcaggacaagctctacaag
gatgcaattgagaccgcggcgctctcgggcaaggctgaggtggtggaggagctccttcgc
tactttgtggacattggcagcagggaatgctacgttggtatgctgtatgcctgctacgac
cttatccgtcccgatgtgatcatggaggtctcgtggcgccacggccttcacgatttcacc
atgccctacatgatcaacttcctgtgcgagcagacgcgtacgatcgagatgctcaagaag
gacaacgaggagcgcaagaagcgcgaagtcacacagaagaccgaagaggacaacacaccg
atcctgggtggctcgcggctgatgttgacccagggtccagcggcgcccgtgccaagtcct
atgccgtatcaacagaccaacgggatcacgccgcaggccaccggcttccgcccgttctag

DBGET integrated database retrieval system