KEGG   Aspergillus oryzae: AOR_1_14134Help
Entry
AOR_1_14134       CDS       T01018                                 

Gene name
AO090102000010
Definition
pectinesterase A
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
aor  Aspergillus oryzae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AOR_1_14134 (AO090102000010)
   00500 Starch and sucrose metabolism
    AOR_1_14134 (AO090102000010)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AOR_1_14134 (AO090102000010)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MHGSLLKLALLSFSLGSSAAVLPRDTGRTSAPSGCSTVGTSGDYSTIGDALTALGSSTAD
ACIYIAAGTYEEQLVINYAGHLTLYGETTDTQTYKQNTVTITHTISSPEAGSLDNSATVN
IKSDLVSVYNINIANGYGSGAQAVALVANADQLGFYACQFTGYQDTLYAKAGHQYYINSR
IEGAVDYIFGDASAWFENCDIVSNGAGYITAMSRETTSDTAWYAIDHCNIKAASGVDLTG
DVYLGRPWRVLARVIYQYSVLPDIINAKGWHSMADGATPLYYEFNNTGAGSDTSDREYLS
TIDAPVTKETVLGDDYKNWVDLSY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcacggttccctcctgaaacttgctctattgagcttcagtctcggtagttctgcagct
gtcctacccagggacacaggtcgaaccagtgcgccatctggatgttctacggtaggcacg
tctggcgattattcaaccatcggcgatgctctcactgctctaggctcatcgacggcggac
gcatgtatttacattgccgctggcacgtacgaggagcagctggttattaactatgcgggt
cacttgacattatacggagagacaacagatacacaaacctataagcagaataccgtcacc
atcactcataccatatcatctccggaggcaggttccctcgataacagtgccactgtcaat
atcaagtcggacttggtttcggtgtacaatatcaatatagcgaatggatatgggtcaggc
gcgcaggccgttgccctcgtcgcaaatgccgaccaacttggcttttatgcatgccaattc
acagggtatcaggatactttgtatgccaaagccggccatcagtactatatcaattctcgg
attgaaggagctgtcgattatatctttggcgacgcatctgcctggtttgaaaattgcgat
atagtctcgaatggtgctggttacatcaccgccatgtcgcgtgaaaccacttcggacact
gcttggtatgccattgaccactgcaacatcaaggcagcgtcgggagtggatctgactggc
gatgtatacctgggccgaccctggcgcgtcctcgcccgcgtgatctatcagtactcagtc
ctacccgacattattaacgccaaaggttggcattctatggcggatggtgcgacgcctctc
tattatgagttcaacaatactggtgctggatccgacacatcggaccgagagtatctaagt
accattgatgctcctgtgaccaaggaaacagttttaggagacgactataaaaattgggtc
gatttaagctattag

DBGET integrated database retrieval system