KEGG   Aspergillus oryzae: AOR_1_1414054Help
Entry
AOR_1_1414054     CDS       T01018                                 

Gene name
AO090011000842
Definition
protein bimA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
aor  Aspergillus oryzae
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:aor00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AOR_1_1414054 (AO090011000842)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AOR_1_1414054 (AO090011000842)
   04113 Meiosis - yeast
    AOR_1_1414054 (AO090011000842)
Protein phosphatases and associated proteins [BR:aor01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AOR_1_1414054 (AO090011000842)
Ubiquitin system [BR:aor04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     AOR_1_1414054 (AO090011000842)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 808 aa AA seqDB search
MSPSTSHISGQLRQLIYYHLDNNLIRNALFLAGRLHAYEPRTSEASYLLSLCHLLNGQIK
AAYDYSKNFGSRGTHLGCSYVYAQACLDLGKYLDGIAALERSKSLWTSKNHWNKHSETRR
QHLPDAAAVLCLQGKLWHAHKDLNKGVECYVEALKLNPFMWDAFLGLCETGVNIRVPNIY
KMSSELLSVLSSSQEDIDLPPDKVAPAGGPLQTSANVNPSLDPFMSAASRSDSGTTHGSS
ALWEKLNGSTVSVASNGTSTPAVREGTETPGGQSSESDDFRLANGVGDTSWEPPLAPARK
NRTIQSIGADHAMDPPPKMKPTGIRQRTRMRVEQEEQTTTQVEKESVTGSRVGDRKRTVS
GQVAHPPAPTEPGAPQRRSVRLFNQIKPTTSKLSGTALGTKDGRELKKVKATGAKGRATA
ATGVGRVVSGNRKHVGEIHESDGKEHRPVSTVHSGATNVASKAATIEKSKSIEALTWLLE
LFSKLASGYFALSRYRCTDSIQIFNALSQGQRETPWVLSQIGRAYYEQAMYSDAEKYFVR
VRNIAPSRLDDMEIYSTVLWHLKNDIELAYLAHELMEVDRLSPQAWCAIGNSFSHQRDHD
QALKCFKRATQLDSHFAYGFTLQGHEYVANEEYDKALDAYRHGISADSRHYNAWYGLGTV
YDKMGKLDFAEQHFRNAASINPTNAVLICCIGLVLEKMNNPKAALIQYGRACSLAPHSVL
ARFRKARALMKLQELKLALAELKILKDMAPDEANVHYLLGKLYKMLHDKANAIKHFTTAL
NLDPKAAQYIKDAMESLDDEEEDDEDMA
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgtcgacatcccatatatcgggccagttgaggcagctaatatactatcacctt
gataacaatctgattcgcaatgcgctatttcttgctggtcgtctgcatgcctatgaacct
cgaacatcggaggcttcctatctactctccctatgccatctactcaacgggcaaatcaag
gcagcttatgactacagcaagaattttgggtcgaggggtactcatttgggctgctcgtat
gtgtatgcgcaggcgtgtctagacttaggaaagtatcttgatgggattgcggcgctggaa
cggagcaaaagcctttggacttctaagaatcattggaacaaacacagcgaaacacgcagg
cagcacctacccgacgcggctgcagttctatgcttgcagggtaaactatggcacgctcat
aaagacctcaataagggagtagaatgctatgtcgaagctttgaaattgaatccttttatg
tgggatgcatttctgggtttgtgcgagacaggtgtcaatattcgggtccctaatatttac
aaaatgagctccgaactactttccgttctatcgtcatcacaggaagatattgatcttccg
cctgacaaggttgcgcctgcaggtggaccgctgcaaacttcagcaaatgtgaatccaagc
ttggacccctttatgtctgccgcatcccgcagtgactcgggcactacccatggaagctct
gccttatgggagaaactgaacggaagcactgtcagcgtggcatcgaatggaacatcaaca
ccagctgttcgggaaggaacagaaacccctggtggccagagcagtgagtctgatgacttc
cgcctggctaacggggttggggatacctcgtgggaacctcccttagctccagccagaaaa
aatcgcacgattcaatcgatcggggcagatcatgcaatggatcccccgccgaaaatgaag
cctacgggtatcagacaaagaacgagaatgagggttgaacaagaggaacaaacgacaacc
caagtggaaaaggaatctgtgacaggatctagagttggcgaccgcaagcgaacggtttcc
ggccaggtagctcatccaccagcaccaacagaaccaggagcccctcaacgccgcagcgta
cgtcttttcaaccagattaagcctacaactagcaagctctcaggcacggcattaggcaca
aaggacggcagggaactcaaaaaggtaaaagctactggtgccaaggggcgtgctacggca
gccacgggtgtaggtcgtgttgtgagcggtaacaggaaacatgtcggcgagatacacgag
agcgatgggaaagaacatcgtccggtatcaactgttcatagtggggctaccaatgttgcc
tctaaggccgcgacgattgaaaagtcgaagtccattgaagctctgacatggctgttggag
ctcttctccaaactggcgtcgggatactttgctttgagtcgttatcggtgtacggattct
atacaaatattcaatgcgctatctcagggtcagcgagagacgccttgggttctttcgcaa
atcgggcgagcgtactacgagcaagcaatgtattcagacgccgagaagtatttcgtacgg
gtgagaaacatagcaccgtccaggttggatgacatggagatttactcgactgttctttgg
catctgaaaaacgacatcgaactagcctatttggcgcatgagctaatggaggtcgaccgt
ttatccccccaggcatggtgcgccattggcaattccttctcgcaccaacgcgatcacgac
caggccttaaagtgtttcaagcgagcgacacaattagattctcattttgcctatggtttt
accttgcagggacacgaatatgtagcaaacgaagaatacgataaagcactggatgcctac
cggcatggcatcagtgctgatagccgccactacaatgcgtggtacggattgggcaccgtt
tatgacaaaatgggcaaactcgactttgctgaacaacatttccgtaacgcagcaagtatt
aaccctacaaatgcggtgctcatctgttgtattggtctggtcctggaaaagatgaacaat
ccaaaggcagctctaattcaatatgggcgagcctgttcattggcaccacattccgtcctt
gctaggttccgcaaggctcgcgcattaatgaagctgcaagagctcaaattggctctagca
gaattgaagattcttaaagacatggccccagacgaagcaaacgtgcattatctcttgggt
aagctttacaaaatgctgcatgacaaggccaatgctatcaagcatttcaccacggccttg
aatttagatcccaaggcggcacaatacataaaggacgctatggaatcattagatgacgaa
gaggaggacgatgaagatatggcttga

DBGET integrated database retrieval system