KEGG   Aspergillus oryzae: AOR_1_1414054Help
Entry
AOR_1_1414054     CDS       T01018                                 

Gene name
AO090011000842
Definition
protein bimA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
aor  Aspergillus oryzae
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:aor04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:aor04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:aor04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 808 aa AA seqDB search
MSPSTSHISGQLRQLIYYHLDNNLIRNALFLAGRLHAYEPRTSEASYLLSLCHLLNGQIK
AAYDYSKNFGSRGTHLGCSYVYAQACLDLGKYLDGIAALERSKSLWTSKNHWNKHSETRR
QHLPDAAAVLCLQGKLWHAHKDLNKGVECYVEALKLNPFMWDAFLGLCETGVNIRVPNIY
KMSSELLSVLSSSQEDIDLPPDKVAPAGGPLQTSANVNPSLDPFMSAASRSDSGTTHGSS
ALWEKLNGSTVSVASNGTSTPAVREGTETPGGQSSESDDFRLANGVGDTSWEPPLAPARK
NRTIQSIGADHAMDPPPKMKPTGIRQRTRMRVEQEEQTTTQVEKESVTGSRVGDRKRTVS
GQVAHPPAPTEPGAPQRRSVRLFNQIKPTTSKLSGTALGTKDGRELKKVKATGAKGRATA
ATGVGRVVSGNRKHVGEIHESDGKEHRPVSTVHSGATNVASKAATIEKSKSIEALTWLLE
LFSKLASGYFALSRYRCTDSIQIFNALSQGQRETPWVLSQIGRAYYEQAMYSDAEKYFVR
VRNIAPSRLDDMEIYSTVLWHLKNDIELAYLAHELMEVDRLSPQAWCAIGNSFSHQRDHD
QALKCFKRATQLDSHFAYGFTLQGHEYVANEEYDKALDAYRHGISADSRHYNAWYGLGTV
YDKMGKLDFAEQHFRNAASINPTNAVLICCIGLVLEKMNNPKAALIQYGRACSLAPHSVL
ARFRKARALMKLQELKLALAELKILKDMAPDEANVHYLLGKLYKMLHDKANAIKHFTTAL
NLDPKAAQYIKDAMESLDDEEEDDEDMA
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgtcgacatcccatatatcgggccagttgaggcagctaatatactatcacctt
gataacaatctgattcgcaatgcgctatttcttgctggtcgtctgcatgcctatgaacct
cgaacatcggaggcttcctatctactctccctatgccatctactcaacgggcaaatcaag
gcagcttatgactacagcaagaattttgggtcgaggggtactcatttgggctgctcgtat
gtgtatgcgcaggcgtgtctagacttaggaaagtatcttgatgggattgcggcgctggaa
cggagcaaaagcctttggacttctaagaatcattggaacaaacacagcgaaacacgcagg
cagcacctacccgacgcggctgcagttctatgcttgcagggtaaactatggcacgctcat
aaagacctcaataagggagtagaatgctatgtcgaagctttgaaattgaatccttttatg
tgggatgcatttctgggtttgtgcgagacaggtgtcaatattcgggtccctaatatttac
aaaatgagctccgaactactttccgttctatcgtcatcacaggaagatattgatcttccg
cctgacaaggttgcgcctgcaggtggaccgctgcaaacttcagcaaatgtgaatccaagc
ttggacccctttatgtctgccgcatcccgcagtgactcgggcactacccatggaagctct
gccttatgggagaaactgaacggaagcactgtcagcgtggcatcgaatggaacatcaaca
ccagctgttcgggaaggaacagaaacccctggtggccagagcagtgagtctgatgacttc
cgcctggctaacggggttggggatacctcgtgggaacctcccttagctccagccagaaaa
aatcgcacgattcaatcgatcggggcagatcatgcaatggatcccccgccgaaaatgaag
cctacgggtatcagacaaagaacgagaatgagggttgaacaagaggaacaaacgacaacc
caagtggaaaaggaatctgtgacaggatctagagttggcgaccgcaagcgaacggtttcc
ggccaggtagctcatccaccagcaccaacagaaccaggagcccctcaacgccgcagcgta
cgtcttttcaaccagattaagcctacaactagcaagctctcaggcacggcattaggcaca
aaggacggcagggaactcaaaaaggtaaaagctactggtgccaaggggcgtgctacggca
gccacgggtgtaggtcgtgttgtgagcggtaacaggaaacatgtcggcgagatacacgag
agcgatgggaaagaacatcgtccggtatcaactgttcatagtggggctaccaatgttgcc
tctaaggccgcgacgattgaaaagtcgaagtccattgaagctctgacatggctgttggag
ctcttctccaaactggcgtcgggatactttgctttgagtcgttatcggtgtacggattct
atacaaatattcaatgcgctatctcagggtcagcgagagacgccttgggttctttcgcaa
atcgggcgagcgtactacgagcaagcaatgtattcagacgccgagaagtatttcgtacgg
gtgagaaacatagcaccgtccaggttggatgacatggagatttactcgactgttctttgg
catctgaaaaacgacatcgaactagcctatttggcgcatgagctaatggaggtcgaccgt
ttatccccccaggcatggtgcgccattggcaattccttctcgcaccaacgcgatcacgac
caggccttaaagtgtttcaagcgagcgacacaattagattctcattttgcctatggtttt
accttgcagggacacgaatatgtagcaaacgaagaatacgataaagcactggatgcctac
cggcatggcatcagtgctgatagccgccactacaatgcgtggtacggattgggcaccgtt
tatgacaaaatgggcaaactcgactttgctgaacaacatttccgtaacgcagcaagtatt
aaccctacaaatgcggtgctcatctgttgtattggtctggtcctggaaaagatgaacaat
ccaaaggcagctctaattcaatatgggcgagcctgttcattggcaccacattccgtcctt
gctaggttccgcaaggctcgcgcattaatgaagctgcaagagctcaaattggctctagca
gaattgaagattcttaaagacatggccccagacgaagcaaacgtgcattatctcttgggt
aagctttacaaaatgctgcatgacaaggccaatgctatcaagcatttcaccacggccttg
aatttagatcccaaggcggcacaatacataaaggacgctatggaatcattagatgacgaa
gaggaggacgatgaagatatggcttga

DBGET integrated database retrieval system