KEGG   Aspergillus oryzae: AOR_1_142034Help
Entry
AOR_1_142034      CDS       T01018                                 

Gene name
AO090103000074
Definition
tannase subunit
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     AOR_1_142034 (AO090103000074)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 588 aa AA seqDB search
MRQHSRMAVAALAAGANAASFTDVCTVSNVKAALPANGTLLGISMLPSAVTANPLYNQSA
GMGSTTTYDYCNVTVAYTHTGKGDKVVIKYAFPKPSDYENRFYVAGGGGFSLSSDATGGL
AYGAVGGATDAGYDAFDNSYDEVVLYGNGTINWDATYMFAYQALGEMTRIGKYITKGFYG
QSSDSKVYTYYEGCSDGGREGMSQVQRWGEEYDGAITGAPAFRFAQQQVHHVFSSEVEQT
LDYYPPPCELKKIVNATIAACDPLDGRTDGVVSRTDLCKLNFNLTSIIGEPYYCAAGTST
SLGFGFSNGKRSNVKRQAEGSTTSYQPAQNGTVTARGVAVAQAIYDGLHNSKGERAYLSW
QIASELSDAETEYNSDTGKWELNIPSTGGEYVTKFIQLLNLDNLSDLNNVTYDTLVDWMN
TGMVRYMDSLQTTLPDLTPFQSSGGKLLHYHGESDPSIPAASSVHYWQAVRSVMYGDKTE
EEALEALEDWYQFYLIPGAAHCGTNSLQPGPYPENNMEIMIDWVENGNKPSRLNATVSSG
TYAGETQMLCQWPKRPLWRGNSSFDCVNDEKSIDSWTYEFPAFKVPVY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaacactcgcgcatggccgttgctgctttggcagcaggagcgaacgcagcttct
tttaccgatgtgtgcaccgtgtctaacgtgaaggctgcattgcctgccaacggaactctg
ctcggaatcagcatgcttccgtccgccgtcacggccaaccctctctacaaccagtcggct
ggcatgggtagcaccactacctatgactactgcaatgtgactgtcgcctacacgcatacc
ggcaagggtgataaagtggtcatcaagtacgcattccccaagccctccgactacgagaac
cgtttctacgttgctggtggtggtggcttttccctctctagcgatgctaccggaggtctc
gcctatggcgctgtgggaggtgccaccgatgctggatacgacgcattcgataacagctac
gacgaggtagtcctctacggaaacggaaccattaactgggacgccacatacatgttcgca
taccaggcactgggagagatgacccggatcggaaagtacatcaccaagggcttttatggc
cagtccagcgacagcaaggtctacacctactacgagggttgctccgatggaggacgtgag
ggtatgagtcaagtccagcgctggggtgaggagtatgacggtgcgattactggtgccccg
gctttccgtttcgctcagcaacaggttcaccatgtgttctcgtccgaagtggagcaaact
ctggactactacccgcctccatgtgagttgaagaagatcgtgaacgccaccattgctgct
tgcgacccgcttgatggaagaaccgacggtgttgtgtcccggacggatctttgcaagctt
aacttcaatttgacctctatcatcggtgagccttactactgtgctgcgggaactagcact
tcgcttggtttcggcttcagcaatggcaagcgcagcaatgtcaagcgtcaggccgagggc
agcaccaccagctaccagcccgcccagaacggcacggtcaccgcacgtggtgtagctgtc
gcccaggccatctacgatggtctccacaacagcaagggcgagcgcgcgtacctctcctgg
cagattgcctctgagctgagcgatgctgagaccgagtacaactctgacactggcaagtgg
gagctcaacatcccgtcgaccggtggtgagtacgtcaccaagttcattcagctcctgaac
ctcgacaacctttcggatctgaacaacgtgacctacgacaccctggtcgactggatgaac
actggtatggtgcgctacatggacagccttcagaccacccttcccgatctgactcccttc
caatcgtccggcggaaagctgctgcactaccacggtgaatctgaccccagtatccccgct
gcctcctcggtccactactggcaggcggttcgttccgtcatgtacggcgacaagacggaa
gaggaggccctggaggctctcgaggactggtaccagttctacctaatccccggtgccgcc
cactgcggaaccaactctctccagcccggaccttaccctgagaacaacatggagattatg
atcgactgggtcgagaacggcaacaagccgtcccgtctcaatgccactgtttcttcgggt
acctacgccggcgagacccagatgctctgccagtggcccaagcgtcctctctggcgcggc
aactccagcttcgactgtgtcaacgacgagaagtcgattgacagctggacctacgagttc
ccagccttcaaggtccctgtatactag

DBGET integrated database retrieval system