KEGG   Aspergillus oryzae: AOR_1_1468144Help
Entry
AOR_1_1468144     CDS       T01018                                 

Gene name
AO090023000838
Definition
3-oxo-5-alpha-steroid 4-dehydrogenase family protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     AOR_1_1468144 (AO090023000838)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 336 aa AA seqDB search
MGPTISTLNSLPPLQDLLHPTPETYTQILNIWQYFASFTVVIWLTTWFPMGKTSLKSSIF
NIPGRLAWTAMELIAPLNLIYVMKALVAKLNTDLTSLPLPNQTVAALYLIHYANRAVISP
LFAAPSMSPIHAFIAVCGLSFNWINSTCLAAWLVGYHVPVTGYRADGSGPGIVLFFVGMA
GNIISERTFFRLRREEADKLHNTQKDHSKNPGTKNKYSKVYVIPPAKGLFRYILYPHYVF
EWLEWTGFVLVGTAVYPAAGAVGPEMGLVPWLRPAAALAEKLRVPLPLPAVVFVVNVVTS
MVPQARLGKRWYLGRFGKDKVAGRGAVVPFLGWLSV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggggccgaccatctcaaccctcaattctctcccaccccttcaggatctcctccaccca
accccagaaacatacacccaaatcctcaacatctggcaatacttcgccagcttcacagta
gtcatatggctaaccacctggttcccgatgggcaaaacctccctaaaatcctccatcttc
aacatccccggccgcctcgcctggaccgccatggagctcatcgcgcccctaaacctcatc
tacgtgatgaaagccctcgtcgcaaaactcaacacggacctcacgtccctgccactcccg
aatcagaccgtagccgcgctgtatctcatccactacgctaatcgcgcggtcatctctccg
ctgttcgcggccccgagcatgtcccccatccatgctttcatcgccgtctgcggtctgtct
ttcaactggattaattcgacctgccttgctgcatggttggtgggataccatgtccctgtg
accgggtatagagcagatgggtctggtcctggaatcgtcctcttcttcgtcggaatggca
ggaaacatcatctccgagcgaacattcttccgactccgccgcgaagaagcagacaagctg
cacaacacccagaaagatcactcaaagaatcccggaaccaagaacaagtactccaaagtc
tacgtcatcccgcccgcaaagggccttttccggtacatcctctacccgcattacgtcttt
gaatggctcgagtggacgggcttcgttctcgtgggaacggccgtgtaccctgcggctggt
gccgttgggcctgagatgggacttgtgccgtggttgcgtcctgcggctgcgttggcggag
aagttgcgggtgcccttgccgttgccagcagtggtttttgtggtgaatgttgtgacgtcg
atggtgcctcaggccaggttggggaagaggtggtatttgggacgctttgggaaggacaag
gttgctgggaggggggcggtggtgccttttttggggtggttgtcagtttag

DBGET integrated database retrieval system