KEGG   Aspergillus oryzae: AOR_1_150074Help
Entry
AOR_1_150074      CDS       T01018                                 

Gene name
AO090038000092
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aor  Aspergillus oryzae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AOR_1_150074 (AO090038000092)
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AOR_1_150074 (AO090038000092)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 347 aa AA seqDB search
MATKPQICVIGSLNIDFVTYARRCPGPGETLTGSSLSIDAGGKGANQAVACARAAFTSRT
QQDVAVRMIGAVGANDPYYPTLLQPALEKSGVDTTGIEQRSDCQTGSATIIVEEGEQGEN
RIVVVPGANHDGMNDVDKLLSVVQTQCPAPPQVVVLQGEIPRSTVIGLMQHYNKSENPTN
VVLNIAPVYPDGIPLAALSGTAVLIMNETETIQMAESIPDFPVGSQTEADLQPELLAPLF
HQVAKIPIVLITLGAKGVFFSTATGRNGSVRGVRVKNVVDTTAAGDTFVGYFSAEFARYA
ATGQPLEDFDALIEPAVQQANQAAAMCVQRKGAIESIPFAYEITDRQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggccacaaaaccacagatctgcgtcatcgggtccctcaacatcgacttcgtcacatat
gcccgccgctgtcccgggcctggcgaaacgctaacaggttcctccctgtccatcgatgca
ggcggcaaaggcgccaaccaagcggttgcatgcgcacgagcagcttttacctccagaacc
cagcaagatgtggctgtgcgtatgattggtgcagtcggtgcgaatgatccatattatccg
acgttattacagccagcattagaaaagtcaggggtggataccacgggaatcgagcaaaga
tcagactgccaaacaggctcggcgactatcatcgtggaggaaggcgagcaaggggagaac
cgcattgtcgtggtaccgggagcaaaccatgatggaatgaatgatgtcgataagctcctt
tccgttgtccagacacagtgtcctgctcccccgcaggtcgtggttctgcagggagaaatt
ccgaggtcaactgtgattggtctgatgcagcattataataagagcgagaatccgacgaat
gtcgtcttgaatattgcacccgtgtatccggatggtattcccctggctgcattgtccggc
acagctgtcttgatcatgaatgaaacggagactatccagatggcggaatcaattcctgat
ttcccggtgggatctcaaaccgaagccgatctgcaaccggagctgttggctccactgttc
caccaggtggctaagattcccattgttttgatcacgctcggtgcgaagggggtgttcttc
tcaacggccaccggtcggaacggctctgttcgcggcgtgcgtgttaagaatgtggtggac
accaccgccgctggagatacctttgtgggctacttttcggctgaatttgcgaggtacgct
gccacgggacagcctctcgaggactttgacgctttgatcgagcctgcggtacagcaggcg
aatcaggcagccgccatgtgtgtgcagagaaagggcgccattgaaagtatcccatttgca
tatgagatcacagatcgccaatga

DBGET integrated database retrieval system