KEGG   Aspergillus oryzae: AOR_1_1528194Help
Entry
AOR_1_1528194     CDS       T01018                                 

Gene name
AO090012000870
Definition
profilin
Orthology
K05759  
profilin
Organism
aor  Aspergillus oryzae
Brite
Exosome [BR:aor04147]
 Exosomal proteins
  Proteins found in most exosomes
   AOR_1_1528194 (AO090012000870)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 124 aa AA seqDB search
MSWQDYVDYQLIQKGLAHAAFIGEDLVVWASSEGFNLSEAERRAMFDAFENQDHFYESGL
DLTGRHFHPAAADDRIIRVVQEGNGAMLVRMKGFIIVGEYGNLAPAQGQYFINKLADQLT
AAGF
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagactatgttgattaccaattaatccaaaagggacttgctcatgccgcc
ttcataggagaagatcttgttgtttgggcatctagcgagggttttaatctatctgaagct
gaacggcgtgcaatgtttgacgcattcgaaaatcaagatcatttctatgaatcaggctta
gatcttactggacgacactttcatcctgcagccgctgatgatcgcattatcagggttgta
caggagggaaatggggcaatgctggtgaggatgaagggtttcatcattgtgggtgaatac
ggcaatcttgcgcctgcacaggggcagtatttcataaacaaactagcggaccagctcact
gcggcgggcttctga

DBGET integrated database retrieval system