KEGG   Aspergillus oryzae: AOR_1_1532054Help
Entry
AOR_1_1532054     CDS       T01018                                 

Gene name
AO090011000910
Definition
NADPH cytochrome P450
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 699 aa AA seqDB search
MTPPWPLPLNIPPDALQELSKTLTPTGIADYSALTIFSVAAATYLSRGYLWDQPDPYQHL
VYERPQLKNGGAAGSATKETRNIAKKLEESRKDMVVFWGSQSGTAEGFANRLAREISLRF
GLSAMTADLSDYDPETIAEVPQSKLVGFLLSTYGEGDPSDNTAELWDWVNKTKDQGQLLS
SVRYFAFGLGNRNYKYYNRVVDVVVEALDKLGAKAVMPVGKADDAEGATQEDFMTWKESL
FAVLKGLGFQEHEVQYMPTLSVQEDESLEPIDLHNGEPDGGSLKAQCSPIRPLAISASRE
LFNSSDRHCLHIDLDLTSQPEFTYKTGDHLAIWPGNPDSEVERLLQALGLSSRRDVPITI
KSLDSATKVKIPSPTTVATVFRYYLEICGPVNRDNVLGLAQFAPTPDAKAYLQQLGQDKA
SYAAFINKNHVNLGRLLQQASTETWNIPLSYLVETLPLMQPRYYSISSSSVISPRKASIT
VVVSTTPVPENGDELIHGVTSNYLLAVSENLRSAPHPEGLTYHLNGPSDSLQGGKVLSHL
RKSKFKLPTLAKCPLIMVAAGTGLAPFRAFIAERRQLQQIGREIGEMLLIFGCRRHDEDF
IYRDELEEMTSVLGEKLRIVTAYSREDKKQYVQDKISEVGDDVYRLIDEGANFYICGKAE
MAREVEKAVAGVMSQKGQDEANEWRTRMKRRNKWQEDVW
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccccgtggcctctgcctctcaacatcccgccggacgctctacaagaactctct
aaaaccctcactcccaccggtattgccgactactcagccctgaccatcttctccgtggca
gccgccacatatctctcccgaggctacctctgggaccagcctgacccataccagcatctc
gtttacgaacgaccacagctcaagaatggaggtgctgccggctctgccacaaaagaaacc
cgaaacatcgccaagaaattggaagagtccagaaaagacatggtcgttttctggggctcc
cagtccggcaccgctgaggggttcgctaaccgcttggcgcgagagatctcgttgcgattc
ggcctgagcgccatgacggcagacctatccgattatgatcctgagaccatcgctgaggtt
ccacagtcaaagctggtcggcttcctcctgtccacctatggcgagggagatcccagtgat
aacacggcggagttatgggattgggtcaacaagaccaaggatcaggggcagctgttgtcc
tccgtaaggtactttgcctttggcctgggaaataggaactataaatactataaccgcgtc
gtcgacgtcgtggtggaggcgctggataaactaggtgcgaaagctgtgatgccagtcgga
aaggccgatgatgccgaaggtgctacccaggaagacttcatgacctggaaggagagccta
tttgccgtactgaagggcctgggattccaggaacatgaggtccagtacatgcccacctta
tctgtacaagaggacgaatccctggagccaattgacttgcataatggagagccggatgga
ggctccctcaaggctcagtgctcgcccattcggcctttggccatctccgcttctcgggag
ctgttcaactcatccgaccgacactgtcttcacatcgatttggatctcaccagccaaccg
gagttcacatacaagaccggtgatcatcttgccatctggcctggaaaccctgactccgag
gtggagcgtctccttcaagccctgggtctctcatcgcgtcgcgacgtgcctatcactatt
aagtcgcttgactccgctacaaaagtgaagattccttccccaaccactgtcgcaactgtc
ttccgttactacctcgaaatctgtggtcccgtgaatcgagacaatgtcttgggactggca
cagttcgccccgacccccgatgcaaaagcatatctccagcaactcggtcaagataaggct
agttatgctgcatttatcaacaagaaccatgtcaacctcggtcgactgctgcaacaagct
agcactgagacgtggaacatccccctatcatacctcgttgaaactctccctctcatgcaa
ccacgatactactctatctcatccagcagtgtaatctccccgcgcaaggcctcaatcaca
gtcgtcgtctcgaccacccctgttcccgagaacggagacgaactgatccacggcgttacg
tccaactacctcctcgctgtctcggagaacctccgctctgctcctcacccagaaggactc
acatatcatctcaacggacccagtgattccctacaaggcggaaaggtgctctcgcacctg
cgtaaaagcaaattcaagctccccactctggccaagtgcccacttatcatggttgcggca
ggcacaggtctggcgccattccgggcgttcatcgccgagcgtcgacagctccagcagatc
ggaagggagattggcgagatgctgcttatcttcggatgtcggagacacgatgaggacttc
atctaccgggatgagctggaagagatgacgagtgtgctaggagagaagctgcgcatcgtc
actgcgtactcgcgtgaggataaaaagcaatacgttcaggataagatctcagaggttggc
gacgatgtttaccgactgattgatgaaggagccaacttctatatctgtggaaaggcggag
atggcaagggaggtcgagaaggcggtggcgggggtaatgagccagaagggtcaggatgag
gcgaatgagtggaggacaagaatgaagagaaggaacaagtggcaggaggatgtgtggtag

DBGET integrated database retrieval system