KEGG   Aspergillus oryzae: AOR_1_1548174Help
Entry
AOR_1_1548174     CDS       T01018                                 

Gene name
AO090005000884
Definition
amylo-alpha-1,6-glucosidase
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
aor  Aspergillus oryzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AOR_1_1548174 (AO090005000884)
Enzymes [BR:aor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AOR_1_1548174 (AO090005000884)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     AOR_1_1548174 (AO090005000884)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1537 aa AA seqDB search
MPVPRQVYLLPLKDDGSPDVPGGYIYLPPPTNPPYSVRFVIEGSSSICREGSLWINIPED
GKPFNRSAFRSFRLHPDFNKNIQIDIPITSPGSFAFYTAYSPLPDFSVAPVETSEPVKTP
THYIDVAPRLLLGGRDLPLNALSIFSVISKFMGRYPTDWENHLNGISQRNYNMVHFTPLM
KRGASNSPYSIFDQLQFDETLFPNGEDDVAQMVKKMEVDHGLLSLTDVVWNHTANNSKWL
EEHPEAGYSVETAPWLEAALELDTALLQFGEDLQTLGLPTEFKTADDLIVVMNVLRERVI
SGLRLWEYYVVNVKADTRRIVDKWTKCPGIDLESDQWSRFALKDFKDLTLKEQASFVREH
AIPTSKSILGRFTRAVDDHLGAAILTALLGPADSNHDEAESRFTQLLDEVNLPFYTEYDA
DVSEIMEQVFNRIKYLRIDDHGPKLGSVTKESPLIETYFTRLPVNEVTKQHKSTALALVN
NGWIWNADALRDNAGPDSKAYLRREVIVWGDCVKLRYGNCPEDSPFLWEFMTKYTRLMAK
YFSGFRIDNCHSTPLGVAEYLLDEARKVRPNLTVFAELFTGSEEADYVFVKRLGINALIR
EAMQAWSTGELSRLVHRHGGRPIGSFDLDLPTAGSSHAIASASTDSQEETIAHIRPCPVQ
ALFMDCTHDNEMPAQKRTAVDTLPNAALVSMCASAIGSVMGYDEVYPKLVDLVHETRLYS
SAFSGPSKGELGSEGGIGSIKKILNELHTMMGADGYDETHIHHDGEYITVHRVHPKTRKG
IFLIAHTSFPGQDGHSILAPTHLTGTRVKPLGAWTLEVEAGEDARAEVLADKDYLRGLPS
TVRETNAIKVEERGHDTIISVLESFATGSIALFETSIPTAEHSAGLDCYITEGADQAFSK
LSLVDLNFVLYRCEAEERDSSDGQDGVYAIPNHGPLVYAGLQGWWSVLESIIRYNELGHP
LCDHLRQGQWALDYIIERLEKVAQKDGHNALNDPTSWLRDKFNAVRELPSFLLPRYFAII
VQVAYNAAWKQGIRLLGESIQKGQEFVHQLGMVSVQQTGYVKTASLWPTRRVPSLAAGLP
HFAVDWARCWGRDVFISLRGLLLCTGRFDDAKEHILAFASVLKHGMIPNLLSSGKLPRYN
SRDSVWFFLQAIQDYTAMVPNGIELLGEKVPRRFLPYEDTWFPFDDPRAYSQHSSITEVI
QEVFQQHARGLSFREYNAGPELDMQMKPEGFQIDVNVDWETGLIFGGSQFNCGTWQDKMG
ESEKAGNKGFPGTPRDGAAIEITGLLYSALTWVGNLYEQGLYPHEGVDIGDGKSVTFRDW
AAKIKNSFERCYYIPESPNDDSRYDVDTKVVNRRGIYKDLYKSGKPYEDYQLRSNFPIAM
TVSPDLFDPYKALTALALADSVLLGPVGMATLDPSDLNYRPNYNNSEDSTDFTTSKGRNY
HQGPEWVWQRGYFLRAFLHFDLARRATPEGRTETYQQVTRRLEGCKRALRESPWKGLTEL
TNKAGAHCSDSAPTQAWSAGCLLDLYYDASRYALKTA
NT seq 4614 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttccacgccaggtctatctgctcccattgaaggacgatggctccccagacgtg
cccggaggttatatctaccttcctccgcccaccaatcctccgtactccgttcgcttcgtg
atcgagggtagcagctcgatctgcagggaaggaagcctgtggataaatattcccgaggac
gggaagcccttcaatcgctcggcattccgaagtttcaggttacatccagacttcaataag
aacatccagatcgatatcccaatcacctctccaggatctttcgcgttctacactgcctat
tccccgcttccggacttctccgttgctccagttgagacgtccgaaccagtcaagacccca
acgcattacattgatgttgcacccaggctacttcttggtggccgtgaccttcctctaaat
gctctttcaatattctccgtgatctctaagttcatgggtagatacccaacggattgggag
aatcatttgaatggaatcagccagcgcaactacaatatggttcattttacgcccttgatg
aaacgcggagcctcgaattccccctacagtatttttgatcaactccaatttgatgagact
ctattccccaacggagaggacgatgtagctcaaatggtcaagaagatggaagtagatcac
gggctcttgtcgctaacagatgttgtatggaaccacactgctaataacagcaaatggctt
gaggagcaccctgaggctggttatagcgtcgagactgctccatggctggaagcagcgttg
gagctagacactgctttgttacagtttggagaagaccttcaaaccttgggtcttccaaca
gaattcaagactgctgacgatctgattgttgtgatgaacgtacttcgtgaacgagtgata
agcggcttgaggctatgggaatactatgtggttaatgttaaagcggacacccgaaggatc
gttgacaaatggacaaaatgtccaggtatcgatctggaaagcgatcaatggtcacggttt
gctctcaaggacttcaaagacctaactcttaaggagcaagcaagctttgtccgtgagcac
gcaatcccaacatctaagagtatacttggaaggtttactcgggcagtcgatgaccacctc
ggtgcggccattttaactgcgctgcttggtcctgcagattccaaccatgatgaagcagag
agcagatttacccaattgctcgacgaggtgaatctgcctttttacacagaatacgacgca
gacgtatccgagataatggagcaagtcttcaatcgcatcaaatacctgagaatagatgac
catggaccaaagcttggttctgtcactaaagagagcccacttattgagacatatttcaca
agactgcccgtcaacgaagttactaagcagcataagtcgacggctcttgcgcttgtgaat
aatgggtggatatggaacgccgacgcgttgcgggataacgctggaccggactcgaaggcc
tatttgcgacgcgaagtcattgtgtggggtgattgtgtgaagctaagatatggcaactgc
cctgaggacagtccatttctttgggagttcatgactaaatacactcgcctaatggctaag
tatttctcgggatttcggattgacaattgccattcaacgccgttgggagtcgcagagtat
ctgttggatgaggcacgaaaagttcgacccaatttgacggttttcgctgagctcttcacg
ggctccgaagaagctgattatgtttttgtcaagagactaggcattaacgcactcattcgg
gaggccatgcaggcctggagcaccggtgaattaagccgtcttgtacaccgccatggggga
cgccctattggcagttttgaccttgacttgcctactgcagggagcagtcatgctatagcc
tctgcaagtactgatagccaggaagaaactatcgctcacatacgcccgtgtcccgtccaa
gcactcttcatggattgtacgcacgataacgagatgccggcccaaaagcgaacagcggta
gatacattacctaacgctgcattggtttcaatgtgcgcctcggctattggaagcgtcatg
ggttatgatgaagtatatcccaagctagttgatctcgttcacgagacacgcctgtattcc
tcagcgttctcaggaccctcgaagggggagctaggttctgagggtggcattgggagcatc
aagaagatcctgaatgagcttcacactatgatgggggctgatggatacgatgagacacat
attcaccatgatggagaatatataactgttcatagagttcacccgaagacacgaaagggc
atattcttgatagcacatacttctttcccgggccaggatggtcattccatcctagcaccg
actcatctcaccggaacacgagtcaaaccacttggggcatggacattggaagttgaagct
ggggaagacgccagagcagaagtcttggcggataaagactacttacgggggttgcctagc
acagttcgagagactaacgcaattaaggttgaggaacgcgggcatgataccatcatttct
gttctggaatccttcgcgacggggtcaattgctctcttcgaaacgtccatcccgacagcc
gagcattccgcagggctggactgttacattacagaaggtgcagatcaggcattctcaaaa
ctcagtctggttgaccttaattttgtactctaccgctgtgaagctgaagaaagggattct
agtgacggtcaggatggagtatatgccatacccaatcatgggccgttggtttatgcaggt
cttcagggatggtggagcgttctggagagcatcattcgatacaacgaactgggacatcca
ctctgtgatcatctccggcaaggccagtgggctcttgattatatcatagaacgtttggag
aaggtggcacaaaaagacgggcacaatgctctaaacgacccgacgtcctggttacgggat
aaatttaatgccgttcgtgagctacccagctttctcctgccgcggtattttgccattatt
gtccaagtcgcgtacaacgctgcctggaagcagggcattcggcttctgggggagagtata
cagaagggacaagaattcgttcatcaactgggcatggtcagcgtccaacaaactggatac
gtgaaaaccgcatccctatggcctacgagaagagtaccaagccttgcagctggcctaccc
cattttgctgtggactgggctagatgttggggtagagacgttttcatatctcttcgaggc
ttgcttctctgtactggccggtttgatgatgccaaagagcatattctcgcctttgctagc
gtcctcaaacatgggatgatccctaatctgttgagcagcggaaagcttcctcgttacaat
tctcgagattctgtgtggttcttcctccaggctatccaagattacaccgcaatggttcca
aatggtatagaactcctcggcgagaaggttcccaggaggttcctgccgtacgaggataca
tggttccccttcgacgaccctcgtgcgtattctcagcattcatcaataacggaggtcatc
caggaggtttttcaacagcatgcccgagggctttcatttagagagtataatgctggccct
gagctcgatatgcaaatgaagcctgagggtttccaaatcgacgtcaatgttgattgggag
acaggcctgatatttggaggtagtcaattcaattgtgggacctggcaagacaagatgggg
gagagtgagaaagccggaaacaaaggatttcctggcacacctcgagatggtgcagccatt
gaaatcactgggcttctctacagtgctttgacatgggttggaaacttgtatgaacaggga
ctttacccgcacgaaggagtagatattggggatggcaaatcagtcacgttccgagattgg
gctgccaagattaagaacagtttcgagcgttgctattacattcccgagagtcccaatgac
gacagtcgatatgatgttgatacaaaggttgtcaaccgtcgtggtatctacaaggattta
tataaatccggcaagccctatgaagactaccaacttcggtctaactttccaattgccatg
actgtgtcgccagatctctttgatccctacaaggctctaacagcgcttgcccttgcggac
tcagttcttcttggtcccgttggtatggctactctcgatccatccgatcttaactatcgt
cccaactataacaactcagaggactctacggactttaccacttccaagggcagaaactat
caccaggggcccgaatgggtgtggcagcgagggtacttcctccgtgctttcctgcacttt
gacctggctcgcagggcaacaccagagggacggacagagacttatcagcaggtgactcgt
cgcttagaagggtgtaagcgagcactcagagaaagcccttggaagggcctcacagaattg
acaaataaagctggtgcacactgctctgactcggctcccacgcaagcatggtcggcaggg
tgcttgttagatctttactacgatgcttcaagatatgccttgaaaacagcgtag

DBGET integrated database retrieval system