KEGG   Aspergillus oryzae: AOR_1_1556114Help
Entry
AOR_1_1556114     CDS       T01018                                 

Gene name
AO090701000887
Definition
endo-1,4-beta-xylanase F1
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 327 aa AA seqDB search
MVQFSSIVQCTLLATAASAYVTSRQAAESLHDAFTAAGKKYFGNIAEQALLENPQNEPII
AADFGALTCENSMKWDATEPTQGGYNFDGADYVVNYAVEKGKLLRGHTLLWHSQLPSWVS
QISDPATLTGVIQDHVTTLVSRWKGQIYAWDVVNEIFAEDGSLRESVFSNVLGEDFVRIA
FEAARAADPDCKLYINDYNLDDASYSKTQGFVSKVGEWIAAGVPIDGIGSQSHFGAGGFP
TSGAQAALEALASTGASEVAVTELDIGGATSDDWVNVVNACLNVKKCIGITVWGVSDKDS
WRADECPLLFDVNYQPKDAYGAIIAAL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtccaattttcatccatcgttcagtgtaccctccttgcaactgctgcttcggcatac
gtgacgagccgacaggcagcggagagccttcacgacgccttcaccgcagctgggaagaag
tatttcgggaatatcgcggagcaggctctgctggagaatcctcagaatgagcccatcatt
gctgcggactttggcgctttaacttgcgaaaacagcatgaagtgggatgccactgagcct
acccagggggggtataactttgatggagctgactatgttgtcaattatgccgtggaaaag
gggaagttgcttcgcggacacactcttctctggcactcccagctcccctcatgggtttcc
cagatcagtgaccctgccactctgaccggtgtcatccaagaccacgtcaccaccctggtg
tcccgctggaagggacagatctacgcttgggatgtggtgaacgaaatattcgctgaggat
gggtcccttcgcgagagtgtgttttcaaacgtccttggagaggactttgtccggatcgcg
tttgaagctgcccgtgccgcggaccccgactgcaagctttacatcaacgattacaacctg
gacgacgcctcctactccaagacccaagggttcgtgagcaaagttggtgaatggatcgct
gcaggagttccaattgatgggattggctctcagtctcactttggtgctggaggcttccct
acgtctggcgcccaggcagcgcttgaggcgcttgcgtcgaccggtgcctccgaagtcgct
gttaccgagcttgatattggaggagccacttcggacgattgggtcaatgttgtcaacgcg
tgtctgaatgttaagaaatgcatcgggattactgtctggggtgtgtctgacaaggattcc
tggcgcgcagacgaatgtcccttgttgttcgatgtgaactaccagccaaaggatgcttac
ggcgctatcattgccgcgctctaa

DBGET integrated database retrieval system