KEGG   Aspergillus oryzae: AOR_1_1560024Help
Entry
AOR_1_1560024     CDS       T01018                                 

Gene name
AO090010000616
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aor  Aspergillus oryzae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AOR_1_1560024 (AO090010000616)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOR_1_1560024 (AO090010000616)
  Lipid metabolism
   00071 Fatty acid degradation
    AOR_1_1560024 (AO090010000616)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AOR_1_1560024 (AO090010000616)
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AOR_1_1560024 (AO090010000616)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 325 aa AA seqDB search
MSTMKAFQFDDVQSGLHLRTVSRPQPAHGQVIIQIKAAGLCHSDCFILQDDQYNMIMKRP
IVLGHEVAGTIIELGPGVSDYEVGDKVVVGIPTHPVAQDSFIKAIGLGYDGGYAEQAMAW
VENLVRIPPGVSFAQAAVANDSIATAYHAVITEGHVSPNSRVAIVGLGGLGLSAIQIAAI
HGARIYAVDIDETKFPLARELGAIGCASGLDKFEDIVFDTVVDFAGAGITTAAAVNAVKP
CGRVVVVGLAAKQMNLDTHSVITRNITLQGSIGSSLEELKEVLRHIADGRLSPILEEISF
DSIPQGLERLAQGKVTGRLFTDPTA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccatgaaagcattccaattcgacgacgtgcagagcggtctccatttgagaacc
gtatcacgtccccaaccagcgcacggccaagtgatcatacagatcaaagcagctggtctg
tgtcactccgactgcttcatcctccaagacgatcaatacaacatgatcatgaagcgacct
atagtattaggtcatgaagtggccgggacgatcatagaactcggtccaggagtctcagat
tatgaagttggtgacaaggtcgtggtgggaatccccacgcatcccgtggctcaggacagc
ttcatcaaagccattgggctcggctatgatggcggttatgcagagcaggccatggcctgg
gtagagaatctcgttcggattccgcccggtgtttctttcgcacaagccgctgttgcgaac
gattcgatcgcgaccgcctatcacgccgtgatcacggaaggccatgtcagtcccaatagc
agggtggctattgtggggctgggcgggctgggtctctctgccattcagattgctgctatt
cacggagctcggatatatgcagtggatattgatgagaccaaattccctcttgctcgggag
ttgggggccatcgggtgcgccagcggacttgataaattcgaggatatcgtgtttgataca
gtggttgactttgccggtgctggcataacgactgcggcagcagtgaacgccgtcaagcca
tgcggtcgcgtggtagtggtcggcctggctgcgaagcagatgaatttggatacgcattca
gtgattaccaggaacattactttgcaggggtcgattggctcgagcctggaagaattaaag
gaggtcttgagacacatcgccgacggtcgtctttctcccattttagaggagatttctttc
gacagcatcccgcagggacttgagcgattggcgcaaggaaaggtgactggtcgtttgttc
acagatccgactgcatag

DBGET integrated database retrieval system