KEGG   Aspergillus oryzae: AOR_1_1582054Help
Entry
AOR_1_1582054     CDS       T01018                                 

Gene name
AO090011000935
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
aor  Aspergillus oryzae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AOR_1_1582054 (AO090011000935)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AOR_1_1582054 (AO090011000935)
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AOR_1_1582054 (AO090011000935)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 416 aa AA seqDB search
MASQRLTIVIKLGTSSIVDESTHEPILSILTLIVEAAAKLRRDGHNVVLVSSGAVGVGLR
RMDVEERPKNLPRIQALAAVGQCRLMSLWDGLFSHLRLPVAQILLTRNDIADRTQYVNAQ
NTFSQLFDMGVIPIVNENDTIAVSEIKFGDNDTLSAITAAMVKADYLFLMTDVDCLYTAN
PRHNPNARPIEVVSDISSLEADVSSAGSSLGTGGMSTKIVAAKLGTSAGVTTIITKSSKP
GNVHEIVKYLQQVKQEEHTHTTTTMNGTVTEAPPLHTRFLPSDHPVQSRTFWLLHGLKPH
GTIFIDHGAYSALQKKASLLPAGVVGVDGHFAQQEAVRLVVVQRLSPDSLNGDFLHHGQE
PKEVGRALVNYGSLEIERIKGHRSTQIQTLLGYADSEYVALRENISFFQQDDPSWR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcaacgtctcacaatcgttatcaaattagggactagttccatagtagatgaa
agcacccatgagccgatactttcgattctcactctgatagttgaagccgccgccaagctt
cgccgggacggccataatgtcgttcttgtttcctcgggggctgttggtgtggggttgcgg
aggatggatgtggaagaaaggcccaagaatttgcctcgcattcaggcactcgcggctgtt
ggacaatgcagactcatgagtctctgggatggtttattttcacaccttcgtttaccagtg
gctcagattctcttgactaggaacgacatagcagatagaacgcaatatgtcaacgcccaa
aatactttttcacagctttttgatatgggcgtgatccctattgtcaatgaaaacgatact
atagccgtttcggaaatcaaatttggtgataacgatacactgtcggccataacagccgcc
atggtcaaggccgactacctttttctgatgacggatgttgactgcctttatactgctaat
ccacgccacaacccaaatgcaagacccatcgaagttgtctcagatatatcctcgttggaa
gccgatgtgtcctcagctggatcctcccttgggactgggggtatgagcaccaaaattgtt
gctgcaaaattaggaactagcgctggcgtaacgacgattatcaccaagagctcgaaacct
ggaaacgttcatgagattgtaaaatatctccagcaggttaagcaagaagaacatacccat
acaaccacaacaatgaatggaacagtcactgaagcaccccctctgcatacacgcttcctc
ccttctgaccatccggttcaatccaggacattctggctgctccacggtctgaagccccat
ggaaccatattcattgaccacggcgcatacagtgccctccagaagaaagccagtctccta
ccagcgggtgttgtcggtgtggatggtcattttgcgcaacaggaggcagtacgtctagtt
gtagtacagagactctcccctgattcattgaatggcgattttctccaccacggccaggag
cctaaagaggttgggcgtgcattggtcaactacggcagcctcgaaatcgagcgcatcaaa
gggcacaggagtactcaaattcagactttgcttggatacgcagatagtgaatatgtcgct
cttcgagaaaatatctccttctttcaacaggacgatccttcatggcggtag

DBGET integrated database retrieval system