KEGG   Aspergillus oryzae: AOR_1_16084Help
Entry
AOR_1_16084       CDS       T01018                                 

Gene name
AO090020000009
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AOR_1_16084 (AO090020000009)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 260 aa AA seqDB search
MIQGSLNAHLVLWKATKKCISMAWYCSGSTNAELVDNLFKAGLVKNERVKNAMLGVDRAH
YAPSRPYSDSPQPIGYGATISAPHMHVHACEYLIDFLRPGSRVLDIGSGSGYLTHVLANL
VTDPSIPDELDGHVIGIDHIPELVDLANKNMHKSDQGCKLLDTGKVKFITADGRLGWPEG
APYDAIHVGAAAEKLHPVLIAQLHAPGRMFIPVDTECDGSPHGFGGGQYIWVVDKREDGS
VHKEKVFQVSYVPLTDPPKK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaggttctctaaatgcacatctagtgctgtggaaggccactaaaaagtgcatc
tcaatggcatggtattgctctggctcaaccaatgcagaattggttgataatctcttcaag
gcgggattggtgaagaatgaaagagttaaaaacgctatgttgggggttgaccgagcccat
tatgcaccttcgaggccttactcagattccccacaacctatcgggtatggtgcgacaatc
tccgctcctcacatgcacgttcatgcatgcgagtacctcatcgatttcctcaggccgggt
tcacgggtactcgatattggctcgggttctggatatctgacccatgtcctcgcaaacctt
gttacagatccctccatacctgatgaattggatggccatgttattggaattgaccatata
ccagaacttgttgacttggctaacaagaatatgcataagtcggaccaagggtgcaaattg
ttagatacaggaaaggtgaagtttattactgctgacggccgtttgggatggccagaggga
gcaccgtatgatgctatccacgttggtgcagcagcagaaaagcttcacccggtactaatc
gcgcaactccatgcccctggccgaatgtttatccccgttgacacggagtgtgacgggagt
cctcatggatttggcggcggccaatatatttgggtagtggacaagagggaggacgggtca
gtccacaaagaaaaggtgttccaggttagctacgttccgctgaccgacccgccaaagaag
taa

DBGET integrated database retrieval system