KEGG   Aspergillus oryzae: AOR_1_166114Help
Entry
AOR_1_166114      CDS       T01018                                 

Gene name
AO090701000094
Definition
calcineurin subunit B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 193 aa AA seqDB search
MEHSSAPNNAALYDARRRRGSVGTSQLLDNIVSASNFDRDEVERLRKRFMKLDKDSSGTI
DRDEFLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKV
YDIDRDGYISNGELFIVLKMMVGNNLKDVQLQQIVDKTIMEADKDQDGKISFEEFTDMVE
NTDVSLSMTLSQI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaacattcctccgcacccaataatgccgccctgtacgatgcgcggagacgcagaggc
tcggtcggaacgtcgcaactattagacaacatcgtctccgcttccaacttcgacagagat
gaggttgagcgactccgcaagcgattcatgaaactggataaggacagctcgggtacaatt
gatcgcgatgaattcctttcccttccgcaagtgtcatccaacccgctggcaacgagaatg
atcgcaatcttcgatgaagatggtggcggtgacgtcgacttccaagaattcgtttcaggt
ctctcggccttctcgtctaagggtaacaaggaagaaaagcttcgcttcgcattcaaggtc
tacgatatcgatcgcgacggttacatctctaacggagaactgttcatcgtattaaagatg
atggttggcaacaacctgaaagacgtgcagctgcagcagatcgtcgataagaccatcatg
gaggcggacaaggatcaggatggaaagatcagcttcgaggagtttacggatatggtggag
aatacggatgtcagtttgagtatgacgctaagccagatttaa

DBGET integrated database retrieval system