KEGG   Aspergillus oryzae: AOR_1_1712144Help
Entry
AOR_1_1712144     CDS       T01018                                 

Gene name
AO090023000962
Definition
longevity-assurance protein (LAC1)
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
aor  Aspergillus oryzae
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AOR_1_1712144 (AO090023000962)
Enzymes [BR:aor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     AOR_1_1712144 (AO090023000962)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 439 aa AA seqDB search
MTKEAPSQSVTELNACVSTGHRPAVKETTFREWVVDNQIGISLTILSMLLAVHHLYPSLR
PYTAPFFQLSYYQASQGVYVQGWDDIYFVASSAIAFTAIRAIVIDWVLRPIAMHTGLKRK
ASVRFAEQGWMWLYYAFFWTFGMYIWSNSNHWMNFAAIWDEWPARGVSGSLKWYLLAQLS
FWIQQIFVINIEERRKDHYQMFTHHIITSTLLTSAYIYGFYNVSNVVLCLMDIVDLLLPT
AKILKYFGYELACNVAFGVFMLTWLITRHIMYPLLCWSIFKEVPARMSYGCYSGTTAEMI
SNDGYPDQLAHLFYPFLNIDGPICMNRTIKWIFLSLLLFLQVLSIIWFAMVIRVAVGVLR
TGNAEDSRSDDEEEEEMEMRISSKDGPNGSAAGSDGTTADWRRLNGSSTVRPRARGRVRL
GEQSDRKALLGRIGCDKPT
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagaagcgccgtcgcagtcggtcacagagctcaatgcctgtgtttccacgggc
caccgccctgccgtgaaagaaaccacgttccgagaatgggtagttgacaatcaaatcgga
atttcattgacaatcctttctatgctattggccgtgcaccatctctacccttctctaaga
ccttataccgctccgttcttccaactatcctactatcaagcttctcaaggcgtttacgtt
cagggatgggatgatatttactttgtcgctagttccgcgatcgcctttacggccatccgg
gccattgtaattgactgggttcttcgaccaattgcgatgcatacaggactgaaacggaaa
gcttcagttcggtttgccgaacaaggctggatgtggctgtactacgcgttcttctggact
ttcggcatgtacatttggtcgaactccaatcactggatgaattttgccgccatctgggat
gagtggcctgctcgcggcgtctcaggctcgctcaaatggtatctcctggcacagctttca
ttctggatacagcagattttcgtcatcaacatcgaggagcggagaaaagaccactatcaa
atgtttacccatcacatcatcaccagcactctcttaacctccgcctatatatacggattc
tacaatgtctctaatgtggttttgtgtctgatggatatcgtggatctcttgttgccaacc
gcaaaaatattgaagtactttggttacgagctggcgtgcaacgttgccttcggtgttttc
atgctcacgtggctgatcacacgtcatataatgtaccctctgctgtgctggtccatcttt
aaggaggttcccgcgaggatgtcgtacggctgttattccggaacaaccgccgaaatgatc
tcgaacgatgggtaccccgatcaactggcccatcttttctacccattcctgaacatcgat
ggtcctatctgcatgaatcgcaccatcaagtggatcttcctatccctcctgctattcctt
caggtgttgtccatcatctggttcgcgatggtcatccgcgttgcggttggtgttctccgt
actggaaatgcagaggactcgcgcagtgatgatgaggaagaagaagagatggagatgaga
atctcgagcaaggatggccctaatggaagtgcggcaggttctgatggcaccactgccgac
tggcgccgattgaacggatcatctaccgtacgccctcgcgcacgtgggcgggttcgactc
ggtgagcagagcgatcgcaaggcactactaggcagaatcggatgcgacaagccaacctag

DBGET integrated database retrieval system