KEGG   Aspergillus oryzae: AOR_1_1746114Help
Entry
AOR_1_1746114     CDS       T01018                                 

Gene name
AO090701000798
Definition
protein kinase
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
aor  Aspergillus oryzae
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:aor00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AOR_1_1746114 (AO090701000798)
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AOR_1_1746114 (AO090701000798)
Protein kinases [BR:aor01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   AOR_1_1746114 (AO090701000798)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1110 aa AA seqDB search
MGNLLKTDLNQTPPENAEFLAPINFDDFHNSIIAESTSVKGTSRSLSDDLWICGSFQIFV
NQCRPNASQECTSTAYDPIIYIKKGFCNAPARDRLRGSYYKSDGCTTAEAYVNGTSGASF
ALYSSDSDRFITCPSSLMRPVAVLHPSEECDTFLQQNYPGSFPLPTPKPRVEHTVPADEE
VPPVPAIPKAYESPKGEPEQPNCTAPRKSHIPVDIAVLKGKSDTESDTNPTASATEDDTM
DLPAKRALKTPEAKHKPTASLGRRNLQPLKLPPLNLLPLGTPMTNKIQAMKDREEDAKSH
TPTGQVVAKTPSTPLTASKANFFAVEDDAVPRTQARSSTAHFVVSTSSGATLRTASSSSA
LASFENTSVGARTNSPYVSYSLPKSNSDVNNLRQKASADYSSRVSQSHKLTGPRPQTQSS
AFSSNAETISQISTPSDPDNNSTSGSSFMNKITITRHRSNSRPQQVTDANTDPTKLEPMP
PPKLPASATWNNLSTAKNTSPTLKPSYFKSKRQVSVSNAAASPIRKPSFSSEQSLSLEHS
ISNESRHSDAPSHRSASSILSPVHRILNSAKSNAAMNSTSSDPNVDPDIQIADDEMRKLN
GRRKDFENAAKELDELRRKAGPKERVSPAQALKMANLNIFERGEIIDFKDIFFCGTQHAK
KHVGDLNAQAANFGYDDDRGDYNIVIGDHLAYRYEVIDVLGKGSFGQVLRCVDHKTGGLV
AVKIIRNKKRFHQQALIEVNLLQKLKEWDPHRRHSVVNFTQSFYFRGHLCISTELLGMNL
YEFIKAHDFKGFSVKLIRRFTKQILSTLVLLHTKKVIHCDLKPENILLVHPMSSEIRVID
FGSSCFENEKVYTYIQSRFYRSPEVILGMSYGMPIDMWSLGCILAELYTGYPIFPGENEQ
EQLACIMEVFGPPEKHLIEKSTRKKLFFDSLGKPRLTVSSKGRRRRPSSKELRQVLKCDD
EAFLDFISRCLRWDPSRRLSPHDALRHEFLTGLKMPSRSRTYTTSLNSPAKRGNTLSTPS
SGRPLPEPPGTSLKHGTFLRSRDVSGSSPVKPIAGKRHSTVSGVQPSTPKRSTTTSTTTP
GSALPRVAGRSISGKPDLATAAAATSLRTK
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatctgttgaaaacagacctaaaccagactccacccgaaaacgcagaattcctc
gcgcccatcaattttgacgacttccacaacagcataatagcggaatcaacctccgtcaag
ggaacctcgcgaagcctttctgacgacctctggatctgcggatcattccagatcttcgtc
aaccaatgccgtccgaacgccagtcaagaatgcacaagcaccgcttacgaccccatcatc
tacatcaaaaagggtttctgtaatgcccccgcacgcgacaggcttaggggctcgtactat
aagtccgacggatgcacgacggctgaagcgtatgtcaacggcacctcaggcgcctccttt
gccttatactcctccgactcagaccgattcattacctgtccgtcctcgctcatgcgccca
gtcgccgtcttacatccctcggaagagtgtgacaccttcctccaacagaactaccccgga
tccttcccgctccctacgcctaaacctcgtgtagagcacactgtgccagcagacgaggaa
gtccctcctgttcctgctattcctaaagcctacgagtctccgaaaggggagcctgagcaa
ccaaattgcacagctcctcgcaaatcgcacattccggtggatattgctgttttgaaaggc
aaatcggacacggagtcggacacaaaccctacagctagtgcaacagaagatgatacaatg
gatctacccgccaaacgagcattgaagactccagaagccaagcacaaaccaactgctagc
ttgggcagaaggaaccttcagccgctgaaattgccgccgttgaatctgttgcctttgggt
acaccaatgactaacaagatccaagccatgaaagaccgagaggaggatgcgaaatcacat
acgccaacgggtcaggttgtcgcgaagactccaagtacccctcttactgcctcgaaagct
aatttcttcgctgtcgaagacgacgctgtaccacgcacacaagcgaggagcagcaccgca
cattttgttgtgagtacgtcttcgggtgctaccttgaggacagccagcagctccagcgca
ttagcatctttcgaaaacacatcagttggtgcaaggacaaattcgccttatgtctcgtac
tcgctccctaagagcaacagtgatgttaataatctccgccaaaaggctagtgcagattac
tcttccagagtgtcacagtctcacaagttgacgggtccacgtcctcaaactcaatcatct
gctttctcttccaatgcagaaacaatcagtcagatctctaccccgtctgatcccgacaac
aacagcacttctgggtcctctttcatgaataagatcacgataacccgccacaggagcaat
tctcgacctcagcaggtaacggacgcaaatacagaccccactaaactcgagcccatgccg
ccacctaagcttccagcgtctgcaacctggaataacctatcaacggcgaagaatacaagt
cccacgctaaagccaagctatttcaagtcaaagcgacaggtctctgtatcaaacgcggca
gcctcgccaatacggaaacccagtttcagtagcgaacagagtctttctttagaacacagc
atttcgaacgagtcgcgtcatagtgatgccccatcccaccgttctgcatcatcgatcctc
tccccagttcacagaatactcaactctgcgaagtcgaacgctgccatgaactccacttct
tccgatccaaacgttgaccccgatatccaaatcgctgacgacgagatgcggaaacttaat
ggcaggcgaaaagatttcgaaaacgcggcgaaagagttagatgaactgcgccgcaaagct
gggccgaaggagcgtgtcagcccagctcaggctctcaaaatggcaaatctgaatatcttt
gagcgtggtgaaattattgacttcaaagatatctttttctgcggaacccaacatgcaaag
aaacatgtcggagacttgaatgcacaagccgctaactttggctacgatgatgatcgcggt
gattacaatattgtcattggggaccacttagcctacagatacgaagtcatcgacgttctg
ggcaagggaagctttggtcaagttctaagatgtgttgatcacaaaacgggcgggttggtt
gctgtgaaaatcatccgcaacaagaagaggttccaccagcaagccttgattgaggttaat
ctgcttcaaaagctcaaagagtgggatcctcatcgtcggcatagcgttgtcaatttcacc
caaagcttctacttcaggggacacctctgcatatctacagaactgctgggaatgaactta
tatgagttcatcaaagcccatgacttcaaaggattctctgtcaaactcattcgccgtttt
acgaaacagattttgagtacgctggtgcttctccacaccaaaaaagtcatccactgcgat
ctcaagccggagaacattctccttgtacacccaatgagttccgagatcagagtcatcgac
tttggctctagctgcttcgagaacgagaaggtctatacctatatccagagtcgcttttat
cgctcaccagaagtcattcttggcatgtcatacggcatgcccattgacatgtggagtcta
ggatgtatcctggctgagctgtacacgggatatcccatcttcccgggagagaatgaacaa
gagcagcttgcctgtatcatggaggttttcgggcctccagagaaacacttgatcgagaag
agtacacggaagaagctcttctttgattccttgggcaaaccgagattaacagtctcctca
aaaggtcgacgtcggcgtccaagttcgaaggagctcaggcaggtcctgaaatgcgacgac
gaggctttcctcgacttcatctcccgctgccttcgttgggacccgtcccgccgtcttagc
ccgcacgatgccctcaggcatgaattcctaacagggctcaaaatgccctcgcggtctagg
acatatacaacgagcttgaattccccggccaagcgggggaatactctatcaaccccgtcg
tcagggcgccctcttccagaaccacctggcacgagtctcaagcatggcacctttctgcgt
agccgagatgtctcaggtagctctccagtcaagccaatagccgggaagcgccactcaact
gtgagtggtgtccaaccgtccacccccaagcgaagtacaactacttctacaacgactcct
gggtcagcattgcctcgcgttgctggtaggagcatcagtggaaaaccagacctcgcaaca
gcggcggctgcgaccagcctgagaactaaataa

DBGET integrated database retrieval system