KEGG   Aspergillus oryzae: AOR_1_1760174Help
Entry
AOR_1_1760174     CDS       T01018                                 

Gene name
AO090005001004
Definition
dual specificity protein kinase
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AOR_1_1760174 (AO090005001004)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 669 aa AA seqDB search
MSTPSTATATHPTHHQQHYGYPHHPPYQPNPPYPTTTAAATSRLATTYPYAVNPATATLP
FTQSPKIVSAAPTPTTTAATMPPTHNGVSASAAPTQTGRRKKPDWGEFYKNGIPKEVIVI
DDTPPPEQSKGSARNFATTSTATAASNGNLPQPAGKKRRTGVESAYDVTYYDRPSFSINP
QHYGEDSSAASISTDRTTSLHTTAPTSLSQGSSGASNGVYYEDANIGQKRKRVTTRKSAR
DEQKRRELENAGDAFLNYIPPPKPIIKAKDVPVPVVRDYANRGEKYDDDDGHYIVTPDTP
LTDRYSIIKLLGQGTFGKVVEAFDKHRKTRVAVKIIRSIQKYRDASRIELRVLSTLASND
RQNRNKCIHLRDCFDYRNHICIVTDLLGQSVFDFLKGNGFVPFPSSQIQNFARQLFTSVA
FLHDLNLIHTDLKPENILLVSNAYQTFTYNRTIPSSSHAISRSARQRRVLLDSEIRLIDF
GSATFDDEYHSSVVSTRHYRAPEIILNLGWSFPCDIWSIGCILVEFFTGDALFQTHDNLE
HLAMMEAVIGDRIDTRLVRQVMQGGRSGSQNQSAKYFIRNKLDYPNDETTRASRKYVRAM
KQMTDFIPTTTKFHRLFLDLLQRIFVYDPKNRITAKDALKHPWFKESIVDDGTEALRIGE
QLQRNTQRR
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactccctccaccgccactgcgacacaccctacgcatcatcagcagcactacgga
tatcctcaccacccgccctaccaaccgaaccctccctatccgaccacgaccgccgcggcc
acctctcgccttgccaccacatatccctacgccgtcaacccggcaactgccaccctaccc
ttcacacaatctccaaagatcgtctcggcggctcccacgccgacgacgacggcggcaact
atgcccccaactcacaatggggtcagcgctagcgcggccccaacccagaccggaaggagg
aaaaagccagactggggcgagttctacaagaatgggatcccgaaggaagttattgtcatc
gatgatactccaccgccggagcagtccaagggctccgctcgcaacttcgcgacgacgtcc
actgcgacggccgcctccaacggaaacctgccccagcccgcgggaaagaaacggcgcacc
ggggtcgagtcagcgtatgatgtgacatattatgaccgtccgtcgttctcgatcaaccct
cagcattatggagaggattcttccgctgcctccatttcaacggatcgcacgacgtctctg
cacactactgcacctacttcgctttctcagggaagctctggtgcgagtaacggtgtttac
tacgaggatgctaatattggacaaaaacggaaacgggtcaccacccgcaaatctgctcgg
gatgagcagaaacggcgagaactggagaatgccggtgatgcgtttttgaactatattcca
cctcccaagccgatcatcaaggcaaaggatgttccagtgcccgttgttcgggactacgca
aaccgaggagaaaagtacgatgacgatgatggtcattatattgtgacaccagacacccca
ttaacagaccgatattcgatcataaaacttcttggccagggaacgtttggaaaagtggtt
gaagcgtttgataagcatcgcaagacccgtgttgcggtcaagatcattcgttccattcag
aagtaccgtgacgcgtcgcggattgagcttcgagtgctgtcgacattggcttcgaacgac
aggcaaaatcgaaacaaatgcatccatttacgcgattgctttgattatcgcaaccatatt
tgcattgtcacggacttgctggggcaaagtgtttttgattttctgaagggaaacggcttc
gtcccctttcccagtagccaaattcagaactttgctcggcagttgttcaccagcgtggcc
tttttgcacgatctcaaccttattcacaccgacctgaagcccgaaaatatcctccttgtc
agtaatgcctatcaaaccttcacctacaaccgcacgatcccatcgtcgtcacacgcaatc
tcccgcagcgcacgtcaaagacgggttttgttggacagcgagattcgtctgattgatttt
ggatccgcgaccttcgatgacgaataccactcttccgttgtttccaccagacattaccgg
gcgccagagatcattctgaacctcggctggagtttcccttgtgatatctggagtatcggc
tgtatactggtcgagttcttcactggagacgctcttttccagacccatgacaatttggaa
catcttgccatgatggaggctgtcataggcgaccggatcgatactcgtcttgtacgacaa
gtgatgcaaggcggacggagtggaagccagaaccagtcggccaaatacttcatccgcaac
aagcttgattatcccaatgatgaaactactcgtgcctcgcggaagtatgtgagggctatg
aaacaaatgacagattttattcccaccaccaccaagttccaccgtttattcctggatctt
cttcaacgcattttcgtttatgaccccaagaaccggatcacggccaaggacgctctcaag
cacccctggttcaaagaatcaatcgtggatgatggcactgaagctctgcggattggggag
cagttgcagcgcaacacccaacgccgctag

DBGET integrated database retrieval system