KEGG   Aspergillus oryzae: AOR_1_180084Help
Entry
AOR_1_180084      CDS       T01018                                 

Gene name
AO090020000105
Definition
protein mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
aor  Aspergillus oryzae
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    AOR_1_180084 (AO090020000105)
Enzymes [BR:aor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     AOR_1_180084 (AO090020000105)
Glycosyltransferases [BR:aor01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   AOR_1_180084 (AO090020000105)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 932 aa AA seqDB search
MSPKSKNALEVQPPTKSTRSSSRSPRPKNRKKAPVETLNYGSDGVKDNSIFSLPTSDYKA
LVLVTLVATAVRLFRIYQPTSVVFDEVHFGGFASKYIKGRFFMDVHPPLAKLLITLAGWL
AGFNGDFDFKEIGKDYLAAGVPYVAMRMLPAIMGVLTVSLMFLTLKASGCRTTTAVLGAG
VVIFENALVTQSRLILLDSPLVFFTALTAMSFTSFTNQQELGPSHAFRGPWWFWLAATGL
CLGATLSVKWVGLFTVAWVGSLTIIQLWVLLGDTNNVTPRLWFKHFFARFFCLIVIPLGF
YCGMFAIHFLCLVNPGEGDGFMSSEFQATLNSKAMQDVPADVAFGSRITLRHHNTQGGYL
HSHNHMYPTGSKQQQITLYPHKDENNVFIAENQTQPLGPDGEIAGPFAWDNITAEYIEDG
AIIRLNHLMTQRRVHSHDERPPVTEADWQYEVSAYGFEGFAGDANDMFRVEIVKSMSEGE
EAKKRLRTIQSKFKLVHVMTGCVLFSHKVKLPDWGWEQQEVTCAKGGTLPNSVWYIESNS
HPMLPADAEKVNYRNPGFLGKFWELQKVMWTTNAGLTESHAWDSRPPSWPTLLRGINFWG
ADHRQIYLLGNPLIWWSSTLAIGIYVLFKGISILRWQRNCADYRNVNFKRFDYEVGTSVL
GWAFHYFPFYLMARQLFLHHYLPALYFAIITLCQEFDFLANRIHALGLASRPAIGKALAG
IFLALSIFTFTLYSPLVYGNPWTPDACRKVKLLDTWDFDCNTFHTDLGQYVTHFTNTNVA
IPTTQAPPPEAPVAPPPQQDQQILKEEAEEADDANVTPEPQPPRAKARVEYRDQDGNILD
EKLVAALAKEGKVSFETRHETRTRLEHGHEVEMINGQVAPPHPDVEGQNPETLGKQEQSA
DDGPASAAGDSSAAEPNSPEAKPASEGNEATN
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccaaatccaagaacgccctggaggtccagcctccaacgaagtctacccgctcc
tcaagtcgctccccgaggccgaaaaaccgcaagaaggcacccgtggaaacgctgaattat
ggttcggatggagtgaaggacaacagtattttcagccttcctacttccgactacaaggcc
ttggttctcgtcaccttggtcgctactgctgtccgtctctttagaatctatcagccgaca
agcgttgtcttcgacgaagtccattttggtggttttgcgtcaaaatatatcaagggccgc
tttttcatggatgttcacccgccactcgctaaacttcttattacacttgcgggttggttg
gctggattcaatggcgatttcgatttcaaggaaattggaaaggactatttggcagcagga
gtcccatatgtggcaatgcgaatgctcccagctatcatgggtgtgcttacggtgtccttg
atgttcttgacattgaaagcatcgggatgtcgcaccacgactgccgtgctaggtgctggt
gtggtgatattcgagaacgccctggtcacccagtctcgtctgatcctcttagactcgccg
ctggtgttctttactgcactcacggccatgtcattcacatctttcacgaaccagcaagaa
ctaggcccatcgcacgccttccgtggaccctggtggttttggttagctgctactggccta
tgtcttggtgctactttaagtgttaaatgggttggccttttcacagttgcttgggttggt
tctctaaccatcattcaactgtgggttcttcttggggatacaaataatgtcactccgcgc
ttgtggtttaagcatttctttgctcggttcttctgcctcatcgtcattccattgggcttc
tactgtggaatgtttgcaatccatttcctgtgtctggtaaatccgggtgagggcgatggt
tttatgtcgtctgagttccaggctacattaaactcgaaggcgatgcaagatgttcccgct
gacgttgctttcggctcccgtatcacgcttcgtcaccataatacgcagggtggctacctt
cattctcacaaccacatgtaccctacaggaagcaaacaacagcagattacactctatccc
cacaaggacgaaaacaacgtcttcattgcggagaatcagactcaacctcttggccctgac
ggagaaatcgcgggtccttttgcctgggataacattaccgctgagtatattgaagatggt
gctatcattagattgaaccacttgatgactcagagaagagtccattcacacgacgagcgc
ccccccgtgactgaggcggattggcaatatgaagtatctgcctatgggttcgaggggttc
gctggtgatgcaaatgatatgttccgcgtagaaatcgtcaagtcaatgtcagagggcgaa
gaagccaagaagcgcttgaggaccatccaatccaaattcaagttggtgcacgtcatgacc
ggctgcgtcctattctcccacaaagtcaaacttcccgactggggctgggagcagcaagag
gtgacttgcgcgaagggaggcaccttgcccaacagtgtttggtacatcgagtccaacagc
cacccaatgctgccggcggatgcagagaaggtcaattaccgaaaccccgggtttttgggc
aagttctgggaactccagaaggtgatgtggacgaccaacgcgggattgacggagtcccat
gcttgggattcgcgacccccgtcgtggccaacgctgctccgtggcattaatttctggggc
gctgatcatcgccagatctacctccttggcaacccacttatctggtggtcctcgacattg
gcaattggcatctacgtactatttaagggaatctccatccttcgctggcaacgtaattgt
gcggactatcggaacgttaatttcaagagatttgactacgaggttggcacaagtgtctta
ggatgggccttccactatttccccttctacctcatggcccggcaactctttctccatcat
tatcttccagcgctttactttgccattatcaccttgtgtcaagaattcgacttccttgcc
aaccgtatccatgctcttggactagcatccaggcccgccattggcaaggcgttggccggt
attttcctcgcactgagcatcttcactttcacactttattctcctttggtctatggcaac
ccctggactccagacgcttgccgcaaggtgaaactattggacacctgggatttcgactgc
aacactttccatactgaccttggccaatatgtaacccactttacaaataccaatgtcgct
ataccaacaacacaggcacctcctcctgaggcccctgtagcccctccaccacagcaagac
caacaaatcctcaaggaagaagcggaagaagcggacgacgctaatgttaccccggagccc
cagccccctcgtgctaaggcacgggttgaataccgtgatcaggatggcaatattttggac
gagaagcttgttgccgcccttgccaaggagggcaaagtatcctttgagactcgccatgag
actcgtactcgcttggagcatggccatgaggtcgaaatgatcaatggccaagtagcccca
ccgcatccagacgttgagggtcagaatcccgagactcttggaaagcaggaacaatctgcg
gatgatggtccagcctccgccgcgggggatagctctgctgcggagcctaattctcccgaa
gcaaagcccgccagtgaagggaacgaggctactaactaa

DBGET integrated database retrieval system