KEGG   Aspergillus oryzae: AOR_1_1802194Help
Entry
AOR_1_1802194     CDS       T01018                                 

Gene name
AO090012001021
Definition
dolichyl-phosphate-mannose--protein mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
aor  Aspergillus oryzae
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:aor00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 741 aa AA seqDB search
MAEMDSASSTGVNLASDMRRRNVPHTEGLRRKPDGTEESKRKPQLKANPSVSILDNWEPL
IMPILLTAVAIFTRMYRIGRSNIVTWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGLSG
YLAGYNGSFEFKSGEKYPEEVNYTFMRVFNAAFGVVCVPLAYYTARELGFRRATIWLVSL
MVLLENSYATISRFILLDSMLLCFTFTTTLCWAKFHRLQYASFSIEWFVWLFLTGISIGC
VCSVKWVGFFCTALVGLYTIEDLWNKFGDLKISEVVFAKHLMARVVGLIIIPVLVYVFSF
YLHFLVLENSGPGDAQMSSLFQANLRGTEVGKDSPLEIALGSRVTLKNMGYGGGLLHSHI
QTYPEGSTQQQVTCYHHKDANNDWFIYPSRREPEYDPSAPLKFVGDGDVIRLIHGQTGRN
LHSHAISAPITKSHYEVSCYGNVTIGDDKDHWLVEVVDDVASKDRSKIRTLTTAFRLRHP
VLGCYLRAGNVNLPQWGFKQIETTCVKENKPSDVYTHWNVESHFNDRLPPGDPGSYKSPF
LKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNVGLRMCSWDDNTIKYYLLGNP
FVYWGSTFSLGIFGLLVIWYLVRWQRGYNELSQADINHIHYSGLYPVIGWILHYLPFIVM
GRVTYVHHYYPALYYAILTFGFCVDWLTQTMDVKSRWVIYSLLYAIIVGMFVHFRVLVFG
IEGSSQQWGHLDWLSGWRIAN
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatggactctgcatcaagtaccggggtcaatttagcttctgatatgcggcgc
cgaaatgtcccgcataccgaggggcttagaaggaagcctgatggcacggaggaaagcaag
cgcaagcctcagctcaaagctaatccatcagtttccattctggataattgggaacctctg
ataatgcccattctgttgacggctgtggctatctttactcgcatgtaccgaattggtcgc
tcgaatattgtgacttgggatgaagcgcactttggcaagttcggatcacattacttgaaa
cgcgagttctatttcgacgtacacccgccgctgggaaaaatgcttgtcggcttgtcggga
tatcttgccggttacaacgggtcgttcgaatttaaatctggtgaaaaatatccggaagaa
gtcaactatactttcatgcgcgtctttaacgctgcgttcggcgtcgtgtgcgtgccactc
gcttattataccgcacgagaacttggcttccgcagagctactatctggctcgtgagtttg
atggtactacttgaaaactcatacgcaacaatctcaaggtttatattactggattccatg
ctactctgtttcacgttcaccactaccctttgttgggcaaagtttcaccgactacagtat
gcgagtttctcgattgagtggtttgtctggctattcctgaccgggataagcattggttgt
gtgtgcagtgtgaagtgggtgggtttcttttgcacagcgcttgtaggcctctatacaatc
gaggatctttggaacaaatttggcgatctaaagatatcagaggtcgtctttgccaagcat
ctcatggctcgtgtggtggggctgatcattatacccgttttggtttatgtattttcgttc
tacctgcatttcttggttctggaaaatagtggaccgggcgatgcccaaatgagttcactt
ttccaggctaatctgagaggaaccgaggtcgggaaagatagccccttggaaattgctctc
ggctctagagtcacactgaagaacatgggctacggcggcggacttctccattcgcatatc
cagacgtaccccgaaggatccacccagcagcaggttacctgttatcaccacaaggacgcc
aacaacgactggttcatctatcccagccgccgcgagccagagtatgatccgagtgcgccc
ctaaagtttgtaggtgatggtgatgtcattcgtcttattcatggacagacaggccggaat
ttgcactctcatgctatttctgcaccaattaccaagtcacactacgaagtctcatgctac
ggcaatgtcactatcggcgatgataaagatcattggttggttgaggtggttgatgatgtt
gcatcgaaggatagaagtaaaatccgtacacttaccactgcgttccgcctgcgacatcct
gtcctgggttgttatttacgagcaggcaacgtcaatctcccccagtggggcttcaaacag
attgaaaccacatgcgtgaaggagaacaaaccgagcgatgtttacacacattggaatgtc
gagtctcatttcaatgaccggctcccacctggtgatccaggatcctacaagtcgcctttc
ttgaaagactttattcatttgaatgttgccatgatgacgtccaacaatgcgttggttcct
gacccagataaacaagatgatctcgcctcgaaattttggcagtggccaatacttaatgtt
gggctccggatgtgctcttgggatgacaatactattaaatactatctccttggcaaccca
ttcgtttactggggaagtacatttagccttggcatctttgggctcttggtaatttggtat
ctcgtgcgctggcagcgaggttacaatgagctttcccaggcagatatcaaccatatccat
tattctggcttgtacccagtcattggatggattctgcattatctgcctttcattgttatg
ggaagagtgacgtatgttcatcattactacccagcattatattacgccattcttaccttt
ggattttgcgttgactggctcacgcaaacgatggatgttaaatcccgctgggtgatctat
tctttactttacgctatcatagttggaatgttcgtgcatttccgcgtgcttgtgtttggc
attgaaggttcgagtcagcagtggggtcatttggactggctgagcggctggcgcatcgcc
aattga

DBGET integrated database retrieval system