KEGG   Aspergillus oryzae: AOR_1_1872054Help
Entry
AOR_1_1872054     CDS       T01018                                 

Gene name
AO090011000838
Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
aor  Aspergillus oryzae
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AOR_1_1872054 (AO090011000838)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOR_1_1872054 (AO090011000838)
   00640 Propanoate metabolism
    AOR_1_1872054 (AO090011000838)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    AOR_1_1872054 (AO090011000838)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AOR_1_1872054 (AO090011000838)
Enzymes [BR:aor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     AOR_1_1872054 (AO090011000838)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     AOR_1_1872054 (AO090011000838)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2283 aa AA seqDB search
MAHVNGTSTAQYNLPSHFIGGNHLEAAAPSSVKDFVAKHGGHSVISSVLIANNGIAAVKE
IRSVRKWAYETFGNERAIQFTVMATPEDLRANADYIRMADQYVEVPGGTNNNNYANVELI
VDVAERMDVHAVWAGWGHASENPRLPESLAASPKKILFIGPPASAMRSLGDKISSTIVAQ
HAGVPCIPWSGTGVEEVKVDDKGIVTVEDEVYNRGCTFSPEEGLQKAKEIGFPVMIKASE
GGGGKGIRKVESEEDFVNLYNAAANEIPGSPIFIMKLAGNARHLEVQLLADQYGNNISLF
GRDCSVQRRHQKIIEEAPVTIAKPTTFQAMERAAVSLGKLVGYVSAGTVEYLYSHADDKF
YFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDPNTSSEIDFD
FSNEESYKTQRRPQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWGYFSVGTA
GGIHSFSDSQFGHIFAYGENRSASRKHMVIALKELSIRGDFRTTVEYLIKLLETPAFEDN
TITTGWLDQLITNKLTAERPDPIVAVLCGAVTKAHQASEAGVEEYRKGLEKGQVPSKDVL
KTVFPVDFIYEGLRYKFTATRASLDSYHLFINGSKCSVGVRALADGGLLVLLDGRSHNVY
WKEEAAATRLSVDGKTCLLEQENDPTQLRTPSPGKLVKFTVENGEHVRAGQAFAEVEVMK
MYMPLIAQEDGIVQLIKQPGATLEAGDILGILALDDPSRVKHAQPFTGQLPDLGPPQVVG
NKPPQRFFLLHSILENILRGFDNQVIMGTTLKELVEVLRDPELPYGEWNAQSSALHSRMP
QRLDTQLQNIVDRARARKTEFPAKQLQKTIARFIEENLNPADAEILRTTLLPLEQVINKY
IDGLKTNEFNVFIGLLEQYYDVEKLFSGRNTRDEDAILKLRDEHKDDIISVVQTVLSHSR
IGAKNNLILAILAMYRPNQPGVGNVSKHFKPILQKLTELESRSAAKVTLKAREVLIQCAL
PSLEERLSQMELILRSSVVESRYGETGWDHREPDFGVLKEVVDSKYTVFDVLPRFFVHQD
AWVTLAALEVYVRRAYRAYTLKGIQYHSSGEPPLLSWDFTLDKLGQPEFGGVTSTHPSTP
STPTTESNPFRRLNSISDMSYLVNDGSNEPTRKGVLLPVQYLEDAEEYLPRALEVFPRAG
SKAKKPSDNGLLATLEGKRRPAPRIESDNELTGVCNIAIRDVEDLDDTQIVSQINGILAD
VKDELLARRIRRVTFICGKNGIYPGYYTFRGPTYEEDESIRHSEPALAFQLELGRLSKFK
IKPVFTENRNIHVYEAIGKGPESDKALDKRYFVRAVVRPGRLRDDIPTAEYLISEADRLM
NDILDALEIIGNNNSDLNHIFINFSPVFNLQPKDVEEALAGFLDRFGRRLWRLRVTGAEI
RILCTDPTTGVPYPLRVIITNTYGFIIQVELYIEKKSEKGEWVFHSIGGTNKLGSMHLRP
VSTPYPTKEWLQPKRYKAHLMGTQYVYDFPELFRQAFQNSWTKAIAKVPSLAEQRPPVGE
CIDYTELVLDDTDNLVEISRGPGTNTHGMVGWLVTARTPEYPRGRRFIIVANDITFQIGS
FGPQEDKFFHKCTELARKLGIPRIYLSANSGARIGMADELIPYFSVAWNDPGKPEAGFKY
LYLTPEVKEKFDASKKKEVITELINDEGEERHKITTIIGAKDGLGVECLKGSGLIAGATS
KAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGREVYTSNLQ
LGGTQIMYRNGVSHMTANDDFEGVQKIVEWMSFVPDRKGSPNPIRPWSDNWDRDIEYHPP
PKQAYDPRWLIAGKEDEEGFLPGLFDAGSFEEALGGWARTVVVGRARLGGIPMGVIAVET
RSVENVTPADPANPDSMEMISTEAGGVWYPNSAFKTAQALRDFNNGEQLPVMILANWRGF
SGGQRDMYNEVLKYGSYIVDALVKYEQPIFVYIPPFGELRGGSWVVIDPTINPDQMEMYA
DEEARGGVLEPEGIVNIKYRRDKQLDTMARLDATYGELRRSLEDSSLSKEQLSEIKTKMA
AREEQLLPVYLQIALQFADLHDRAGRMEAKNTIRRPLTWKNARRFFYWRVRRRLSEELIL
KRMVAAAPSPAPRDASSGAIPTTPAGNVSSTESARSTHLHTLRTWTGMLDDELERDDQRV
ALWYEENKKLIQTKIESLKTESVAADVAQLLIGNKDGGLKGVQQVLSMLPVEEKEAVLKY
LSS
NT seq 6852 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgtcaacggaacctcgacagcccaatacaacctcccctcacattttatcggt
ggtaaccaccttgaagctgcagcgccaagcagtgttaaggactttgtggccaagcatggc
ggtcattcagtaattagttcggttttgattgccaacaatggtatcgcagctgtgaaagaa
atccgttcggtccggaaatgggcctacgaaacattcggcaatgaacgtgcgattcagttt
acggtgatggcaacgccagaagatttgcgggcaaatgcagactatatccgtatggcggac
caatatgttgaggttccggggggcacaaataacaacaactatgcgaacgtcgagctgatc
gttgatgttgccgaacgaatggacgtccacgcggtgtgggccggatggggtcatgcttct
gaaaacccccgcttacctgagtctctcgctgcttctcccaagaagatccttttcattgga
ccaccggcctcggccatgcgctcactgggtgataagatttcgtccacaattgtcgctcaa
catgctggtgtgccttgcatcccgtggtccggaactggtgtcgaggaggtgaaggtcgac
gacaagggcattgtcactgtcgaagatgaagtttataaccgcggctgcaccttctcaccg
gaggaaggtctccagaaagccaaggaaattggtttccctgtgatgatcaaggcctccgaa
ggtggaggaggaaagggtatccgtaaagttgaaagtgaagaggacttcgttaacttgtac
aatgccgccgcgaatgaaattcctggatccccgattttcattatgaagcttgctggaaat
gcccgccacttggaagttcagctgctggccgatcagtacggcaacaacatctccttgttt
ggcagagattgctcggtccaacggcgacaccagaagatcattgaagaggctcccgtaaca
atcgccaaacccacgacattccaggctatggagcgtgcggctgtcagcctcggaaagctg
gttggttacgtgtcagctggtaccgtggaatatctgtactcccatgcagatgacaagttc
tacttcttggaactgaatcctcgtctccaggtcgagcaccctacaactgaaatggtttcg
ggtgtcaacttgccagctgcccaacttcagattgctatgggtattcccctgcaccggatt
cgcgacatccgcttgctctatggtgtggacccgaacacatcttccgagattgacttcgac
ttctccaacgaagaaagctacaagacgcaacgccgcccgcaacctaagggacatacgact
gcttgccgtattacctccgaagatcccggcgagggcttcaagccttccagtggtaccatg
cacgaactgaacttccgcagttcgtctaatgtttggggttacttctctgtcggtacagcc
ggaggtattcacagtttctcagacagtcagttcggtcatatcttcgcctatggtgagaat
cgttctgcgtcaaggaaacacatggttatcgccttgaaggaattgagtatccgtggtgat
ttccggacgactgtcgagtacttgatcaagctactggaaactcctgcattcgaggacaac
acaatcacgactggatggcttgatcagctgatcaccaataaactcactgctgaacgccct
gatcccattgttgccgtgctgtgtggtgcggttactaaggcacaccaggccagcgaagca
ggtgtagaggagtaccggaagggtctcgagaagggtcaagtgccctcgaaggacgttttg
aagaccgttttccctgttgatttcatttacgaaggtctgcgctacaaattcaccgccact
agagcaagcttggacagctaccacctgttcattaacggatccaagtgctctgtcggcgtc
cgtgcgttggccgatggtggcttgctggtcctcctcgacggtcgcagccacaacgtctac
tggaaggaggaagcggctgcgacacgcctcagtgtcgatggtaagacctgcctgctagag
caggagaacgacccgacacagctccgcacgccatctcccggaaaacttgtcaagttcact
gttgagaatggtgagcacgtccgggctggtcaggccttcgctgaagtcgaggtgatgaag
atgtacatgcctttgatcgctcaggaagatggaattgtccaattgatcaagcagcctggt
gctactttggaggccggtgatatcctcggtatcctcgctttggatgatccttcccgcgtt
aaacatgcccagccgttcaccgggcagttgccggatcttggacctcctcaggttgtgggt
aacaagcctccacagaggttcttcctgctccatagcatcctggaaaacattctgcgagga
tttgataaccaagtaatcatgggtactacgctcaaggagcttgtggaagtccttcgggac
cctgagcttccctacggagagtggaatgctcaatcctctgctctgcactctcgtatgcct
cagagactggacactcagcttcaaaacattgtcgatcgtgcacgcgcccgcaagactgaa
ttcccagccaagcagcttcagaagactattgctcgatttattgaagaaaatctcaatccc
gcggatgctgaaatcctgagaacaactctcttgcctctggagcaagtcatcaacaagtat
atcgacggactgaagaccaacgaattcaatgtcttcattggactcttggagcaatactac
gatgtggagaagctattctccggtcgcaacactcgtgacgaagatgctatcctgaaactc
cgagacgagcataaggatgatattattagcgttgtccagactgtgctctcccatagtcgc
attggtgccaagaataacctgatccttgccattctggcaatgtaccgtcccaaccaacct
ggcgtcggcaacgttagcaagcacttcaagccgatcctccagaaactcacagaactcgaa
tcccgatccgccgctaaggtcactctgaaggcacgtgaggttctcatccagtgcgctctt
ccctctttggaggaacgtctctcgcaaatggaactaattttgcgttcctcggttgttgag
tcgcgctacggtgagaccggttgggaccatcgcgaacccgatttcggcgtgttgaaggag
gtggtcgattcgaagtacactgttttcgatgtgctgcctcgattcttcgtgcatcaagat
gcgtgggtcacgctggctgctctcgaggtctatgttcgccgtgcctaccgtgcctacacc
ttgaaaggcattcagtatcactcttccggcgagccgcccctgctgtcgtgggacttcacc
cttgataagcttggacaacctgagtttggcggcgtcacgtctacacacccgtcgactcca
agcaccccaacaaccgagagcaatcccttccgcaggctgaactccatcagtgacatgtcc
tatctggtcaatgatggaagcaacgagcctaccagaaagggtgtccttcttccagttcag
tacttggaggatgcagaggaatacctccctagagccctggaggtctttcctcgggctggc
tcaaaggccaagaagccttctgataatggccttcttgccacactggagggcaagcgtcga
ccagctcctcgaattgaaagcgacaacgagttgactggtgtttgcaatatcgctatccgc
gatgttgaagaccttgacgacacacagattgtctctcaaattaatggaattctggctgat
gtcaaggatgagttgcttgctcgtcgcatccgccgtgtgacttttatctgtggcaagaat
ggcatctacccaggttactacaccttccgaggacctacttacgaggaggatgagagcatc
cgtcacagcgagcctgccctggcgttccagctggaactcggccgtttgtccaagtttaag
atcaagccagtgttcacagaaaaccgtaacattcacgtctatgaagcgattggtaagggt
ccggagagtgacaaagcattggacaagcggtactttgtgcgtgcggtagtgcgtccgggc
cgccttcgtgacgatatccctacggctgagtatctgatctccgaggctgaccgactgatg
aacgatatcttggatgctctcgagatcattggcaacaacaactctgatttgaaccacatc
ttcatcaacttctctcctgtgttcaacctgcagccgaaggacgtcgaggaggctctggct
ggcttcttggatcgtttcggccgtcgcctctggcgacttcgcgtcactggtgctgaaatc
cgtatcctgtgcactgaccccaccaccggagtcccataccctctgcgtgtgatcatcacc
aacacctatggtttcatcattcaggtggaactctacattgagaagaagtccgaaaagggc
gaatgggtcttccacagcattggtggtaccaacaagctcggatccatgcatttgcgccct
gtctccacgccctaccccaccaaggagtggctccaacctaagcggtacaaggctcatctg
atgggcactcaatatgtgtacgatttccctgagctcttcagacaagcattccagaatagc
tggaccaaagccatcgcaaaggtgccatcattggcggagcagcgccctcccgttggtgaa
tgcatcgactacacggagcttgtgctggatgacactgacaacctggtggaaatctcgaga
ggccctggtacgaacacgcacggtatggttggttggctcgtgactgcccgtactcctgaa
tatcctcgtggacggcgattcatcatcgttgccaatgatatcacattccaaattggatcg
tttggtccacaggaggacaagttcttccacaagtgtactgagctggcaagaaagcttggc
attcctcgtatctacctttctgccaactcgggtgctcgtatcggaatggctgatgagctg
attccctacttctcggtcgcttggaatgatcctggaaaacccgaggctgggttcaagtac
ctctacctgactcccgaggtcaaggagaagttcgacgcgagcaaaaagaaggaagttatc
actgagttgataaacgatgaaggtgaagagcggcacaagatcaccactatcatcggtgca
aaggacggccttggtgttgagtgtcttaagggctctggtctaattgcaggtgctacctcc
aaggcctacgaagacatcttcaccatcactctggtcacttgccgttcggttggtatcggt
gcctatctcgtccgtctcggacaaagagctatccaggtcgagggccagccaattatcctc
acaggtgctccggctattaacaagctgttgggcagagaggtctacacatccaacctccaa
cttggtggaacgcagattatgtataggaacggagtttcgcacatgactgcgaatgatgat
ttcgaaggtgtgcagaagattgtggaatggatgtccttcgttcctgacaggaagggatca
cccaatcccatccgtccttggtcggacaattgggaccgtgacatcgagtaccaccctccg
cccaagcaggcctatgaccctcgctggctcattgccggtaaagaggatgaggagggcttc
cttccgggcttgtttgatgcgggatctttcgaagaagctcttggtggctgggctcgtact
gttgttgttggtcgcgcgcgactgggtggtatccctatgggtgtcatcgctgttgagacc
cgctcggtggagaacgttactccagccgacccggccaaccctgactcgatggagatgatc
agcaccgaagccggtggagtgtggtaccccaactctgccttcaagacagcccaagccctt
cgtgacttcaacaatggtgaacaactgcctgtcatgatcctggccaactggaggggtttc
tcaggtggacagcgcgatatgtacaacgaggttctgaagtatgggtcatacatcgtcgat
gctttggtcaaatatgagcagcccatcttcgtctacatcccgcccttcggtgaactccgt
ggtggttcttgggtcgtcattgaccctacaatcaatccagaccaaatggagatgtacgct
gatgaggaagctcgcggtggtgttcttgagcctgagggtattgttaacatcaaataccgc
cgtgacaagcagttggataccatggctcgcctggatgctacttatggtgagctccgacgc
tctctggaagactcgtcgctcagtaaagagcagctgtcggagatcaagactaagatggct
gcccgcgaggagcaacttctgcccgtctatttgcagattgctctgcagtttgctgatctt
catgatcgtgctggccgcatggaggccaagaacactattcgccggccgctcacctggaag
aacgcacgtcgattcttctactggcgtgtgcgtcgccgtctcagcgaggaacttatcctc
aagcgcatggttgctgcggcaccgtctcccgcaccccgcgacgccagcagtggtgccatc
ccgaccaccccagccggaaacgtctcttctactgaatccgctcgctcgactcaccttcac
accctgcgtacctggactggaatgcttgatgacgagttggagcgtgatgaccaacgtgtg
gccttgtggtatgaggagaacaagaagctaatccagacaaagattgaatccctcaagacc
gagtccgttgctgcagatgttgcgcaattgcttatcggcaacaaggacggtggattgaag
ggtgtccagcaggttctgagcatgctgcctgtcgaagagaaggaagctgttcttaagtac
ctttcgtcataa

DBGET integrated database retrieval system