KEGG   Aspergillus oryzae: AOR_1_1906174Help
Entry
AOR_1_1906174     CDS       T01018                                 

Gene name
AO090005001093
Definition
protein kinase wis1
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
aor  Aspergillus oryzae
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:aor04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 644 aa AA seqDB search
MASEIDPVAGVSPSRDLDNKSDTTDDDLSPSVTTPPASVPSLRPTDKIPGITASSTHLGQ
ISAARRGAGTPPRPQASMSSMSGASQGGLNQDILAKMKAFSLSRQGAPPTLPHAASTGTV
PKTPRPGMPPAGLSSPGGQSPPVVNGPLAGALAGRLPPVARPNTKNWVSSPSIPGSSPSP
VSAKPGGLAAKRMKPGLKLSDATGTKGTAGNQSPANGTEGTGETAFSKYSEFIDTKSGTL
NFKNKAVLHGGGIEFSSGHKFSISLDEVDRLDELGKGNYGTVYKVRHSRPHMRKPGMGLR
GIVSRPTGPEASGSDGVTDNLTGVIMAMKEIRLELDENKFAQIIMELEILHRCVSPFIID
FYGAFFQEGAVYICVEYMDGGSIDKIYKDGVPENILRKMALSTVMGLKTLKDDHNIIHRD
VKPTNILVNSRGQIKICDFGVSGNLVASIAKTNIGCQSYMAPERIAGGGVQQSGASGGGT
YSVQSDIWSLGLTIIECAIGRYPYPPETFNNIFSQLHAIVHGEPPTLPESGYSDEAHSFV
RACLDKNPKNRPSYSTLLRHPWIAPLMRPPEESGGDDTTSASAGVTHSSVTEDKEVADWV
KEMLERRNNGLLHDSNKPALHAVALDAVPGSPLLDDPSSISVQP
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgaaatcgatcctgtagcgggggtctcaccttcgagggacttagacaacaag
tccgatactaccgacgacgacctctccccctccgtgaccactccccccgcctcagtgcct
tctttgcgcccgaccgataaaatccccggcattactgcatcgtcgacacacttgggccag
atcagtgcagctcgaagaggcgcgggcacacctccgcgtccgcaggcctccatgagctcc
atgagtggtgcgtcacaagggggcttaaaccaggatattttggcaaagatgaaggctttc
tctctttctcggcaaggcgcacccccgactttgccccatgcggcttcaactggaaccgtg
cctaagactccccgcccggggatgcccccagccggtctgtcgagcccaggaggacaatcc
cccccagttgttaacggtcctttggcgggagctctcgccggccgactgcccccggtagct
cgcccgaacaccaaaaactgggtttcgtctccatcaattcccggctcatcaccgagcccc
gtttccgcgaagccgggtggccttgctgcgaaacggatgaaacctggactcaagctatcc
gatgccaccggcaccaaaggcactgctggaaatcagtctcctgccaacggaactgaagga
accggcgagactgcgttcagtaaatattccgagttcattgacactaaatcggggacactg
aacttcaaaaacaaggcagttctgcatggcggcggaattgagttctcatctgggcacaag
ttcagcatttcgctggacgaagttgatcgtcttgatgaattgggcaagggcaactatgga
acagtgtacaaggtccggcatagtcggccacatatgcgaaaacccggtatgggtttgaga
ggcatcgtcagtcgtccgacagggcccgaagcgtctggctccgatggggtcacggataat
cttactggggtcatcatggccatgaaagagatccgcttggagctggatgaaaacaagttc
gctcaaattatcatggagttggaaattcttcatcgctgcgtctcgccctttatcattgat
ttctacggtgccttcttccaggagggagctgtctacatctgcgttgagtatatggatggt
gggtcgattgacaaaatctacaaagatggcgtccctgagaacatcctccgtaaaatggcc
ttatccactgtcatgggactgaaaacactcaaagacgatcacaacatcattcatcgcgat
gttaaacccacgaatattctcgttaactcgcgaggacagatcaagatctgtgatttcgga
gttagtggaaatctggttgccagtattgccaagacaaacattggttgtcagagctacatg
gctccagagcgaatcgctggcggcggagtccagcaatccggagcaagcggtggcgggacc
tatagtgttcaaagtgacatctggagtttagggttgaccatcattgaatgtgccattggc
cgatatccatatcctccggagacctttaacaacatcttcagtcaactgcacgctattgtt
cacggagagccaccaacacttccggagtctggatattctgacgaagctcattcctttgtc
cgtgcttgtttagacaaaaatcccaagaatcgtccttcgtacagtacgttgctccgacac
ccctggattgcgccccttatgcgcccaccagaggagtcgggcggcgatgatacgacgtct
gcctcggctggggtcacccattcctctgtcactgaagacaaggaggtcgccgactgggtt
aaagagatgctggagcgtcgcaataatggccttctgcatgattctaataagccggcacta
catgctgtcgccttggatgctgttccgggcagccctcttcttgatgatccttcctcaatt
tccgtacagccttga

DBGET integrated database retrieval system