KEGG   Aspergillus oryzae: AOR_1_1914174Help
Entry
AOR_1_1914174     CDS       T01018                                 

Gene name
AO090005001098
Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
aor  Aspergillus oryzae
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AOR_1_1914174 (AO090005001098)
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     AOR_1_1914174 (AO090005001098)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 760 aa AA seqDB search
MPSFTDHNGDSGPDIEGFQPIYGTGLSITSLQKARHANGNGNTAIAPDSRKHHPAISKKA
TARPPLYPTAPLSSQSSAISESGARDEQEMQNGEEDPQNALFHQVLEWLQREKSKRKSPK
VKAHAQPDGSGSDGDDEDDEDAGNGDGGNSERTTSHGADNVFALDKLEKILIQYAASRSD
GAAPAYPARRSTRRRHVKGLRRGSASESDYLDGDSAAPSVDATLDNSKTLAYSGGGAEDD
ENEEGANARRALDREAWFVFKSEILRITHTLQLKGWRKLPMELASDVGVVRLSGALTNAV
YVVTPPQNIPPPRAEDGSYSLVPRKPPPKLLLRIYGPQVDHLIDRENELQILRRLGRKHI
GPRVLGTFNNGRFEEFFEARPLTPKELRDPGTMKQIAKRMRELHEGIELLDNEREGGPMV
FKNWDKWVDRCEQVTNWLDKEIQSKHNDIKAVAEPWRRRGFVCGVPWPTFRKAVDSYRNH
LINSYGGMQEIKRQLVFAHNDTQYGNLLRMEPSSESPLLRPENEHKQLVVIDFEYASANL
PGFEFANHFTEWCYNYHDPERSWACSSRDFPTLEQQHRFISAYLTHRPGLAVRSSPSITP
LMQAGELANITSLAPLDLDAGPDVDQQSLVDAEKAQEDRTEAEIRSLIKQARLWRVFNSA
QWVAWGIVQAKVPGMEEGIAADAATNGHQNGANGTESEGTPSTTPPPDTDVEETDEFDYL
AYAQDRAMFFWADLLSLNLVREEELPAALIQHIKPRIIDY
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgccttccttcaccgaccacaacggggactctggtcctgatattgaaggatttcaaccg
atttacggtaccggtcttagcatcacctcactgcagaaggcccgtcacgcaaacggcaat
gggaataccgcaattgcgcccgactccagaaagcatcatcctgccataagcaaaaaggca
accgcacgcccaccactctaccccacagcgccattaagcagtcaatctagtgccataagc
gagtcaggtgcacgggatgaacaagaaatgcagaacggcgaagaagatccgcagaatgcc
cttttccaccaggtcttggaatggcttcagcgtgaaaaatctaaacggaaatctcccaaa
gtaaaagcgcatgcacaaccagatggttcgggtagcgatggggatgatgaggatgatgaa
gacgctggtaatggggatggtggcaactcggagaggacaacttcccatggggccgacaat
gtatttgccttagacaagctggagaagatcctcatccagtacgctgcttcacgcagtgac
ggcgctgcgcctgcttatcccgctcggcggtcaacccgccggcgtcatgtgaagggccta
cggaggggttctgcctctgaatctgattacctagatggcgactcagctgctcccagtgtt
gatgcgacattagacaactctaaaaccctcgcgtacagcgggggtggtgccgaagatgac
gagaatgaagaaggtgcaaatgccaggcgggccctggatcgggaggcttggtttgtattc
aaaagtgagatactgcgtatcactcacacgctacaactcaaggggtggcggaagctgccg
atggaactcgccagtgatgtaggagtagttcgactgagcggtgcgctaaccaatgctgtg
tatgtggtcacgccgcctcagaatatccctccccccagggccgaagatggctcttacagc
ctcgttcccaggaagcccccaccgaagctgcttctgcgcatttacgggccccaggtggat
cacctcatcgaccgggaaaacgaactgcagattctacgtcgtttggggcgcaagcacatc
gggccccgagtgctgggaactttcaataacggccgcttcgaagagttcttcgaggcccgt
cctttgactccaaaagaactgcgcgatcccgggacaatgaagcaaatcgcaaagcgtatg
agagagctgcatgagggcattgagttactcgacaatgagagggaggggggaccgatggta
tttaagaactgggacaaatgggtggaccgctgcgaacaagtcaccaactggttggataag
gaaatccagtccaagcacaatgatattaaagcagttgcagaaccttggcgacgccgaggc
tttgtctgcggtgttccgtggccgacgttcaggaaagccgtcgacagttaccgaaaccac
ctcataaacagctatggtggcatgcaggagatcaagcggcaacttgtctttgcccataat
gatactcaatatggtaatcttcttcgaatggaacctagttctgagtctcctctccttcgg
ccggaaaatgagcacaagcagctggttgtcattgatttcgagtatgcatccgcgaatctc
cctggatttgagttcgcaaaccattttaccgaatggtgctacaattatcacgacccagaa
agatcctgggcatgcagtagcagagacttccccaccctggagcagcaacatcgctttatc
agtgcttatttaacacatcgacctggcttggccgtgcggtcatctccatctataacccca
ctcatgcaagcaggagaacttgctaacatcacttcactcgctcctttggacctggacgca
ggacctgatgtggaccaacagagcttggtagatgctgagaaggcccaggaggaccggacg
gaagcggaaatccgatcactaatcaagcaggctcggctctggcgtgtgttcaactcagcg
cagtgggtggcatggggaatagtgcaagcgaaggtgcccggcatggaagagggcatcgca
gccgatgctgcgacaaatggccatcaaaacggcgccaatggcacagaatccgaggggact
ccttcaacaacccctccaccggatactgatgtagaggaaacagatgaatttgattatctt
gcttatgcccaagaccgggccatgttcttctgggcagatttgttatcattaaacctcgtt
cgggaggaggaattgcctgcagctttgattcaacacattaaaccccgcattatcgactac
taa

DBGET integrated database retrieval system