KEGG   Aspergillus oryzae: AOR_1_1980154Help
Entry
AOR_1_1980154     CDS       T01018                                 

Gene name
AO090003001112
Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aor  Aspergillus oryzae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AOR_1_1980154 (AO090003001112)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOR_1_1980154 (AO090003001112)
   00620 Pyruvate metabolism
    AOR_1_1980154 (AO090003001112)
   00640 Propanoate metabolism
    AOR_1_1980154 (AO090003001112)
  Energy metabolism
   00680 Methane metabolism
    AOR_1_1980154 (AO090003001112)
Enzymes [BR:aor01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AOR_1_1980154 (AO090003001112)
Lipid biosynthesis proteins [BR:aor01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AOR_1_1980154 (AO090003001112)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 670 aa AA seqDB search
MADGNVMPPKPSVVLEAHEVDTFHVPKAFYEKHPTGTHLKDLDEYKKLYDESIRSPQTFW
ARMARELLSFDKDFQTTHTGSLENGDSAWFVEGRLNAAYNCVDRHALKNPDKVAIIYEAD
EPNEGRTITYGELLREVSRVAWVLKQQGVKKGDTVAIYLPMIPEAVVAFLACSRIGAIHS
VVFAGFSSDSLRDRVIDAGSKVVITTDEGKRGGKVIGTKRIVDEALKQCPDVTSVLVYKR
TGTEVPWTQGRDVWWHEEVEKYPNYFPPESVSSEDPLFLLYTSGSTGKPKGVMHTTAGYL
LGAAMTGKYVFDIHDDDRFFCGGDVGWITGHTYVVYAPLLLGCSTVVFESTPAYPNFSRY
WDVIEKHQVTQFYVAPTALRLLKRAGDEHIHHKMAHLRILGSVGEPIAAEVWKWYFEKVG
KEEAHICDTYWQTETGSNVITPLGGITPTKPGSASLPFFGIEPAIIDPVSGEEISGNDVE
GVLAFKQPWPSMARTVWGAHKRYMDTYLNVYKGYYFTGDGAGRDHDGYYWIRGRVDDVVN
VSGHRLSTAEIEAALLEHHMVAEAAVVGIADELTGQAVNAFVSLKEGNETNEQVRKDLVM
QVRKSIGPFAAPKAVFVVDDLPKTRSGKIMRRILRKILSGEEDSLGDTSTLSDPSVVDKI
IETVHTARGK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggcaacgtgatgccccctaagccctctgtggtgctggaagcccacgaggtc
gatactttccatgtccccaaggctttctacgagaagcacccaactggcactcacttgaaa
gacctggatgaatataagaagctctatgacgaatcaattcgcagtcctcaaaccttctgg
gcccgcatggcccgtgaactcctttccttcgacaaagactttcaaactacccacactggt
tctctggagaacggcgacagtgcctggttcgtggaaggccgcttaaatgctgcctacaac
tgcgtggaccgtcatgctctcaagaaccccgacaaggttgcgatcatttacgaggctgat
gagccgaatgagggccgtactattacctacggggagctgcttcgtgaagtatctcgagtt
gcctgggtgcttaaacagcaaggtgtcaagaaaggtgatactgtagctatctatcttcct
atgattccggaggccgttgtagccttcttggcctgttcccgcattggtgccatccactcc
gtggtgtttgcaggattctcgtcagactcgctccgtgaccgtgttatcgacgccggatct
aaagtggtcatcaccaccgacgagggcaagcgtggcggcaaggtgattggcaccaagcgt
attgttgacgaggctttgaagcagtgccccgacgttacaagcgtgttggtctacaagcgc
accggtactgaggtcccctggacccaaggtcgtgatgtctggtggcacgaggaggtggag
aagtaccccaattacttccctcccgagtccgtgagctccgaagaccccctgttcctgctt
tacacttctggttcgacaggaaagcccaagggtgttatgcacaccaccgctggatatctc
ctgggtgccgctatgaccggcaagtatgtctttgatatccacgacgacgatcgctttttc
tgtggtggtgacgtcggttggatcactggtcatacctatgttgtgtatgctcctttgctc
ctgggatgctccaccgtcgtctttgagagtaccccagcgtaccccaacttttctcgctac
tgggatgttattgagaaacaccaggtgactcagttctacgtcgctcctacagcattgcgg
ttgttgaagcgcgctggagacgagcacattcaccacaagatggctcacctgcgtatcctg
ggctccgtcggtgagcctatcgctgcagaggtttggaagtggtatttcgagaaggtcgga
aaggaagaggcacacatttgcgatacctactggcagaccgaaactggttcgaacgtcatc
acacctttgggtggaattacccctacgaaacccggtagtgcctcgttgccgttcttcggt
attgagcctgccatcattgaccctgtctccggagaggaaatctcgggcaatgacgtggaa
ggtgtgcttgccttcaagcagccctggcctagcatggcccgcactgtgtggggtgcccac
aagcgttacatggatacctatctgaatgtttataagggctactacttcactggagatgga
gcaggacgtgaccacgacggatactactggatccgcggccgtgttgacgacgtagttaac
gtatccggtcaccggctgtccaccgctgagattgaagctgccctgcttgaacaccatatg
gttgctgaagctgccgtggtcggtattgctgacgaactcactggccaagcggtcaatgca
tttgtgtctctgaaggagggcaatgagacaaatgagcaggtccgtaaagaccttgtcatg
caggttcgcaagtcgattggaccattcgccgctcccaaggccgtctttgtcgttgatgac
ctccctaagactcgcagcggcaagatcatgcgacgtatcctgcggaagatcctgagcggt
gaggaggacagtctgggtgatacttctaccctgtccgatccctcggtagtcgacaagatc
atcgaaaccgttcacaccgcccggggcaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system