KEGG   Aspergillus oryzae: AOR_1_2008154Help
Entry
AOR_1_2008154     CDS       T01018                                 

Gene name
AO090003001123
Definition
protein mst2
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AOR_1_2008154 (AO090003001123)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1082 aa AA seqDB search
MTATAPPADDDTEMRLPPDLVDSDQDAEGEEETDLYQMDQQLQDAVHRAYSGEVAEESNS
ASREDDRDAEGEPDSDLDSNGENDETEPVGAVKLPKGKSSLDNEDAADAEGDAAFENQSD
SDQDASGSSSSSRGSDEEDDDEEWDGESNDHDDAEVDNNTVRGNCIFCGQDEDHDPSEDF
EEYLTCTVCGDHSHRQCAREQSALNDAEDASTWRCPTCVREKLEPDAEGNNSSHRRLGPK
NMQKELLPAHTGEEGSGFHSIFNTVDIDDDNLLNSSRSLRKRKTLSADVQEHTPVLRKRQ
RQTSLRSERAESRDHLGDASDALSPVRTRSRRVRGGEKENCRVVLRQFGRLMLAFRLNET
KLSKILGSRSRSQHRGRRTPKPPPVAHEPPAHFAPIVPVSYVSPFYSFNDREMDESKSKP
YGGILSEADADTTKTLPTQPDRERFEVARQKAEEEWQRRVMEAESGGEPVQHAAQKVSGP
PSRIKYINFGGYEIETWYAAPYPEEYSRNRVLYICEFCLKYMNSDYVAWRHKLKCPAKHP
PGDEIYRDGSISIFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYIMTEFDDLG
CHFVGYFSKEKRPSSANNVSCILTLPIHQRKGYGNLLIDFSYLLTRIEGKTGSPEKPLSD
MGLVSYRNYWRLILSYQLHKQKTPLSIVELSERTGMTADDIVSGLEALRALVRDPVTKTY
ALRLDYKYFEECIQSWESKGYVQLNPDALVWTPYIMGRSNQSQFDRAPLHAVAPREGLED
EEVEDVKDSGNEEEQQLSESLGKVNGDDSPQPTINGAAQAVSGELSAEPAGPPSTELLTN
GSGLHRTQLAADSKSTESNPIQDIPAWRFEVYPPVQAPVVKRRPGRPFGSKTTYNKVAVT
PTTARTSGRNTPRRSSALASMTPTANASSVRRGRSAKLLDSPAVESTGTEANGVENDGQL
PDHEGDKGGEQDPAQPDGLSETDVQNNHTGDHDAPGQLNGINGVETVDTELHVTEQVTPT
KEVSAENTAKLTRSVNRKAVVEKFEFVIPAEDHGTTNHNAVVEEHTDGPNGVDKDGDAIM
ET
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaactgcgccgccggctgacgatgataccgaaatgagactacccccggatctg
gttgacagcgatcaggatgcggagggagaggaggagacggatttgtatcagatggatcaa
cagctccaggatgctgtacatagggcatattcgggagaggttgcagaagaaagcaacagt
gctagccgcgaggacgatagagatgcggagggggagccggattctgatctggactctaac
ggcgaaaatgatgagactgagccggtgggagctgtgaagttaccgaaggggaaatcttcc
ttggataacgaggatgcggccgacgcagaaggtgacgcagctttcgagaaccaaagtgac
agcgaccaggacgcatccggctctagttcaagcagccggggatccgatgaggaggatgac
gatgaggagtgggatggtgagagtaatgaccatgacgatgcagaagtggataacaacacg
gtgcgcggtaactgcatattttgtggtcaagatgaagatcacgatccgagtgaggacttt
gaggagtatctgacatgcacagtttgtggcgatcactctcaccggcaatgtgcccgcgaa
caaagtgcattaaatgatgccgaagatgccagcacatggagatgtcctacatgcgttcgg
gaaaaactggaaccagacgctgagggcaataattcgtcccatcgaaggctcggcccgaag
aacatgcaaaaagagctcttgccagcacacactggagaggaaggctctggctttcactca
attttcaatacagtggatattgatgatgataacttattgaacagctcgcgatcgctacga
aaaaggaaaaccttgtcagcagatgtacaggaacatacacccgtgcttcgaaaacggcag
agacagacatcattacggtccgagcgggctgagtcgagagaccatttgggcgatgcttca
gacgccctatctccggtacggactcgttctcgccgtgtgcggggaggggaaaaggaaaat
tgccgcgtggtattaaggcagtttggaaggcttatgttagcttttcgactcaacgagacc
aagctatctaaaatcctcggttctcgcagtcggtcacagcacagaggtcgaagaacccct
aagccgcctccagtggcacatgaacctccagcacattttgcccctattgtccccgtgtca
tacgtgtctcctttctattctttcaacgatcgcgagatggacgaatctaaatccaaaccg
tacggtggcattctgtcagaagcagacgctgacaccaccaagactcttccgacacagcct
gaccgtgagaggttcgaagtagcgcgacaaaaggctgaagaagagtggcaaagacgagtc
atggaagccgagagcggcggagagcctgtacagcatgcagcacagaaggtctcgggtcca
ccgtccaggataaagtacatcaactttggtggctatgagattgagacctggtacgcggcg
ccttatccagaagaatacagccgtaaccgtgtgctttacatctgtgagttttgcttaaag
tacatgaactcggattatgtcgcatggcgccacaaactcaagtgcccggcaaagcatcct
cctggagatgaaatctaccgcgacggctcgatttcaatcttcgaagtcgacggaagaaag
aacccggtatactgccagaatctctgcctgcttgcaaaactgtttctcggttcaaagacc
ctatattacgacgtcgagccgtttcttttctacatcatgaccgaatttgacgacttgggc
tgccatttcgttggctattttagcaaagaaaaacggcccagctccgcaaataacgtttcc
tgtatccttactctgcctattcatcagcgaaaaggctatggtaaccttctcatcgacttc
tcatacctactcacgcgcatcgaagggaaaacggggtctcccgagaagccgctttcggat
atgggtttagtgtcttatcggaattactggaggcttattctgtcataccaacttcataag
cagaagacgccacttagcatcgtggagctttcggagcggacaggcatgacagcggacgac
attgtttctggccttgaagctttgcgtgcacttgtcagagatccagtgacgaagacttat
gcattacgacttgactacaaatacttcgaagaatgcatacagagctgggaaagtaaaggc
tacgttcagcttaatcccgatgctcttgtgtggacgccctacataatgggtcgaagcaac
cagtcacagttcgatagggctccgttacatgcagttgccccacgggagggtttagaagac
gaggaggtcgaggacgtgaaggattctggaaacgaggaagagcaacaactttcagaaagt
ctgggcaaagtcaatggagatgatagccctcaaccgaccattaatggtgctgcgcaagct
gtgtccggggaactttcagctgaacctgccggacctccttcgactgaacttttgactaat
ggttctggccttcatcgcacacaactagctgcagactctaaatccacagaatcaaaccca
atccaagatataccagcctggcgatttgaggtttatcctcctgttcaggcgcctgttgtc
aaacgacgcccaggtcgtccctttggcagcaagaccacatacaacaaggtagctgtcact
ccgacaactgctcgcactagtggtcgtaacacacctagaagatcatctgcactagcctct
atgacccctactgcaaatgcatctagcgtccggcgcggtcgaagtgcaaagttactagac
tctcctgcagttgaatcaactggcactgaggccaacggtgtcgaaaatgatggccagctg
ccagatcatgagggtgacaagggcggggaacaagacccagctcagcctgatggattatcg
gagacagatgtccaaaataaccacacgggagatcatgacgcgccgggtcaacttaatggt
atcaacggggtggaaaccgtggacacagagcttcatgttacagaacaagtgacgcctacc
aaagaagtaagtgctgagaatacagccaaacttactagatccgtgaatcgaaaggcggtg
gtagaaaagttcgaattcgttattccggcagaagatcacggtactacgaaccataatgcg
gtggtggaagagcacacagatgggcctaacggggtggataaagatggtgatgcgatcatg
gagacatga

DBGET integrated database retrieval system