KEGG   Aspergillus oryzae: AOR_1_2038174Help
Entry
AOR_1_2038174     CDS       T01018                                 

Gene name
AO090005001174
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aor  Aspergillus oryzae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:aor01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aor00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aor00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 448 aa AA seqDB search
MSRRSMHYLRGCYPRALRTTSAQHASSILPSRCRLPSTVRPIVFTQKKNWQSLQLRQFSA
SALHAAETKIICVPSMAESISEGVLSTFNRQVGDYVEQDEEVASIETDKIDVAVNAPQSG
MITKLIVNEGDTVTVGQAVIEISLEERDTTSQSPLPPQAEQTSKTPQEATQKQQIPTREI
TPSQEPKKGTTPTPTPKTTPQPVPNSQGPVSAFQGSRSETKVKMSRMRLRTAERLKESQN
TAAFLTTFNEADMSKIMALRSQNKDDVLQKHGVKLGFMGPVARASALALREIPAINASIE
NDDTIVFHDYIDLSVAVATPKGLVTPVLRNMERQGIVEIEQGIAELGKKARDGKLTMDDL
VGGSFTISNSGIWGSLFGTPIINIPQTAVLGIYGIQQRPVAIDGQVEIRPMMYTALTYDH
RLVDGREAVTFLTLVKKYLEDPASMLIA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaggcgttcaatgcattatctccggggctgctaccctcgcgcccttcgaaccaca
tcagctcaacacgcgtccagcatattacctagcaggtgcaggctcccatcaacggttagg
ccaattgtgttcactcagaaaaagaactggcaatcattgcagctacgccaattcagcgca
tctgccctccatgcggccgaaaccaagatcatttgcgtcccatccatggccgaatccatc
tccgagggcgtcctgtcgaccttcaacagacaggtcggcgactacgttgaacaagatgaa
gaggtcgcctctatcgaaacggacaagatagatgtcgccgtaaatgcaccacagagtgga
atgatcacaaagttaattgtcaacgagggcgacaccgttacagtgggacaagctgttatt
gagattagcctcgaagagcgcgatacaacttcacagtcaccactaccaccgcaagccgaa
caaacttctaaaactcctcaggaagccactcagaagcaacaaatacctactagggaaata
acaccctcccaagagccaaaaaaaggaacaactcctactcctaccccaaagactactcca
cagcccgtaccaaacagccaaggtccggtatcagcctttcaagggagtcgatcagagacg
aaggtcaaaatgtctcgtatgcgtctgcgcacggcagagcgtctaaaagaatcgcagaac
acagccgcattcttgacgacgttcaacgaagcggacatgagcaagattatggcgttacgc
tctcaaaacaaggatgacgtgcttcagaaacacggcgtcaagctaggcttcatgggcccg
gtggcgcgggcctccgcgctggctcttcgggagattccggctatcaatgcgtccattgag
aatgatgatacgattgtcttccatgactatatcgaccttagcgttgccgtcgcgactccc
aaaggcttggtgacaccagtgctgcgtaatatggaaagacagggcatcgtggaaatcgag
cagggtatcgccgagctggggaagaaggctcgcgatggcaagttgactatggatgacctg
gtcggtgggtcctttacgatcagtaatagcggaatctggggttcgttgtttggcactccc
attatcaatatcccgcagacggccgtgcttgggatttacggaattcaacagagaccggta
gctatcgatggacaggtcgagattcgtccaatgatgtatactgcattgacctacgatcat
cggctagtcgacggccgtgaagcagttacgttcttgacactggtaaagaagtatcttgag
gacccagccagtatgcttatcgcgtga

DBGET integrated database retrieval system