KEGG   Aspergillus oryzae: AOR_1_208094Help
Entry
AOR_1_208094      CDS       T01018                                 

Gene name
AO090120000125
Definition
ubiquitin carboxyl-terminal hydrolase 6
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
aor  Aspergillus oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 572 aa AA seqDB search
MASIPVIVKHQGKRHEVELDLSSNGETLKYQLYSLTGVEPERQKILVKGGQLKDETPLSS
LNAKPGQTFMMMGTPSGGQGSGDLGRPKEAVKFLEDMTEAEAARAEGAIPAGLQNLGNTC
YLNSTLQTLRSVPELHQELLRYRPSTGAAGASNLSDLSSFGLGGLGASMDLTSSLRDLFK
QMSETQEGFPPLMFLNALRNVFPQFAQRDRNGHGYAQQDAEEAWSQIVTQLRNKLMIKEG
EGESSNEVSFVDKYLAGRFESVTECDEPGAKEAGEQPTPSSDVFYKLDCHIGKETNHLHD
GIKAGLEEKIEKRSPTLDRDAIYTKRSRIARLPKYLTVHFVRFFWKRETQKKAKIMRKVT
FPAELDAVDFCTDELKKELIPIRDKVREIRKEELDVERARKRQKLDRQRDEEKKTEAEPE
PLEPMQKKKAAEERKDASKATEKDGDSAMTDVFKSDAEYEAEKAASILAAKKELSELIDP
KLRSDEGTNKSGLYELRGVITHQGASADSGHYTAYVKKQAQGNKEEDGKWWWFNDEKVTE
VEAEKIETLSGGGESHSALILLYRAIDLPTAN
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctataccagttatcgtgaagcaccagggcaaacgtcatgaggtcgagcttgat
ctatcctcgaacggtgaaacgcttaagtaccaattatattccctcaccggcgtggaaccc
gaacgacagaaaattctggtcaaaggaggacaacttaaggatgaaaccccattgtcctcg
ctcaacgccaaaccgggccagacattcatgatgatgggcacgccatctggaggccaagga
tccggggatttgggccgcccaaaagaagcagtgaagttcttggaggacatgacggaggct
gaggctgcaagagcagagggagctattcctgctggccttcagaaccttggtaacacttgc
taccttaactctacactgcagacattgagaagtgttcccgagctccatcaggagcttctg
agatatcgcccctcaacaggtgctgctggagcatcgaacctctcggatctcagcagtttt
ggtcttggtggcctcggcgcctcaatggatcttacgtcttcgttgcgggatctattcaag
caaatgtctgaaacgcaagagggatttccgcctcttatgttcctgaatgctttgaggaat
gtgtttccccagttcgcccagagagatcgaaacggccatggttatgcccagcaagatgct
gaagaggcatggtctcaaatcgtaacccaactgcggaacaagctgatgatcaaggagggt
gagggtgagtccagcaatgaagtatcttttgtggataaataccttgctggaaggtttgag
tctgttacggaatgtgatgagccgggagcaaaagaggctggcgagcaacccaccccaagc
tcggacgtcttctacaagcttgactgtcacatcggcaaagaaacaaatcacttgcatgat
ggcataaaagccggtcttgaagagaagattgaaaagcgttcccctactctagaccgtgat
gccatttacaccaagcgttcacgcattgctcgattgcccaaatacttaactgtgcacttc
gttcgtttcttttggaaacgcgaaacccagaagaaggccaagatcatgcgtaaggttaca
ttccctgccgagctggatgcggtagacttctgcacagatgagctcaaaaaggaacttatc
cctattcgagacaaagtacgggagatccgaaaggaagaactcgatgttgagcgtgctcgc
aagcgtcagaagcttgaccgccagcgggatgaagagaagaaaaccgaagctgaacctgag
cctttggagccaatgcagaagaagaaagccgccgaagaacgcaaagatgcatcaaaggct
accgagaaggatggtgattccgcaatgactgacgtcttcaagtccgatgcagagtatgag
gctgagaaggcagcttctatccttgcagcaaagaaggagctttccgaacttatcgacccg
aagcttcgctccgacgagggtactaacaagtcaggcctttacgagctacggggagtaatc
acacatcaaggtgccagcgctgacagtggtcactacactgcatatgtcaagaaacaagcc
caaggtaacaaggaagaggatggaaaatggtggtggtttaacgatgagaaagtgactgaa
gtggaagcggagaagattgagactctttctggcggcggcgagtcccattctgcgttgatt
ctcctctatcgcgcgattgacctgcccactgcgaattaa

DBGET integrated database retrieval system