KEGG   Aspergillus oryzae: AOR_1_2096174Help
Entry
AOR_1_2096174     CDS       T01018                                 

Gene name
AO090005001213
Definition
DNA-dependent ATPase
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
aor  Aspergillus oryzae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aor00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AOR_1_2096174 (AO090005001213)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     AOR_1_2096174 (AO090005001213)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 957 aa AA seqDB search
MVFKPFKPPLIRKNTQASNTKPDLPIDTLDNHGPPAKRPRLHQECTVDSAGPSMRTERKP
LVQVSNTCESGDDNVKDESAGERYFNVLWRKPTTKKNKTWDGDGILSVRNGYAHLRDVSG
KDMGRAIQASYLEPGTMLSIGGKEVEIDSEMSKNEYLSGKQFLEAKPSPTPPVAPPKKGF
VSVSGNKPSTSAAKENPGEKGQMQIIPNPASRKQSSISSAYKRPLLENTIIPQKSEEEPV
PRHDPKQPGALVMKRPASAPKGKRIVDVVVDPILAKHLRPHQREGVKFLYECVMGMRSFN
GQGAILADDMGLGKTLQTITLLWTLLKQNPIYENPPEVKKALIVCPVTLINNWRKEFRKW
LGNERIGVFVFDDKRKRLTDFTRGRAYNIMIVGYEKLRTVQEGLAQGAGVDIIIADEGHR
LKTLQNKSGQAIQSLNATKRVILSGTPIQNDLKEFFAAVDLVNPGVLGNFKAFVREFEVP
IVKSRQPEATRKDIEKGEARNEELRELTSQFMLRRTADILANYLPPKSEYILFCDPTPTQ
ANIYQNVLASPVFQCAVGNSENALQLITILKKLCNSPSLLSPRNVDEKPSETIAALLSSL
PPNLLRHFSPSSSAKIRVLDQLLHILHTSTSEKVVLVSNYTSTLNLLATLLTSLSLPFLR
LDGSTPAQKRQSLVEDFNRFPTNRCFAFLLSAKAGGTGLNLIGASRLILFDVDWNPATDI
QAMARIHRDGQKRHCRIYRILLKGSLEEKIWQRQVTKLGLADSVMEHKDNAAQFSRDELK
DLFRLDQDSKCQTHELLGCDCGGRGQNVSTSDSHAGSPADGQGNVLDSDDSEEVEEDFPD
VLTLIKASKLDMKKQERMIEATRGARRGGRTTKSTDGTKSDKQKDKMQQSLSQYSHIDPC
HLTTTTDDTQDIQQVIDDDVLLSMLKEEDNRISFVFKKSSVALAKDTDSSMPVVLSD
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggtctttaaaccgttcaaacctcctttgataaggaaaaacacgcaggcttcgaataca
aaaccagacctccccatcgatactcttgacaaccatggcccgccagctaagaggccgcgt
ctgcaccaagaatgtaccgtggatagtgcaggtccatcgatgagaactgagaggaagcct
ttggtccaagtgagcaatacatgtgaatcaggagacgacaatgtcaaggacgagtctgca
ggagagcggtattttaatgttttatggcggaaacctaccactaagaagaataagacctgg
gatggtgatggtatactctcagtgcggaatggctatgctcatttgcgagacgtctcgggc
aaggacatgggccgggctatacaagcctcttatcttgaacctggaactatgctctcgatc
ggaggcaaggaagttgagatcgactccgaaatgtcgaagaacgagtatctgtccgggaag
cagtttcttgaagcaaagcctagcccaactccgccggtagcgccaccgaagaaaggtttt
gtgtctgtgtcgggaaacaagcctagcacgtcggctgccaaggagaacccaggggagaaa
ggtcaaatgcagattattccgaatcctgcatcgaggaaacagagctctatatctagcgca
tacaaaagacccctgttagaaaatactattatcccacagaaatctgaggaggagcccgtt
cctcgtcatgaccccaagcagcccggtgcactggtgatgaaacggccagcatccgctcct
aaggggaaaagaattgtcgacgttgtggttgatcctattcttgccaaacacttgcggccg
catcagcgtgagggagttaagttcctttatgaatgtgtcatggggatgcgatcgttcaat
ggccaaggtgctattttagcggacgatatgggcctgggtaaaaccttgcagacaatcacg
ctattatggaccttgcttaaacagaatccgatctatgagaatccccctgaagttaagaaa
gcacttatcgtgtgccctgtgactttgatcaataactggaggaaggaattccggaaatgg
cttgggaatgaacgaattggcgtatttgtctttgatgacaagcgaaaacgactgactgat
tttaccaggggtagagcatacaatatcatgattgttggttatgaaaaattaagaaccgtg
caagaaggacttgcacaaggagctggggtcgacatcataattgcggatgagggccacaga
ctcaaaacacttcaaaataagagtggacaggcgatacagtcgctgaatgccactaaaaga
gtgattctctcgggtactccgatccagaatgacctgaaggaattcttcgcggcggtggat
ctcgtgaacccgggagttctgggaaatttcaaggcatttgtacgcgaattcgaggttcct
attgtgaagagcagacagccagaggcaacaaggaaagatatcgagaagggagaagccaga
aatgaagagctccgtgaacttacctctcagttcatgctacggagaaccgcggacattctt
gcaaactaccttccaccaaagtcagaatacatactcttttgcgacccaacgcccacccaa
gcgaacatttaccaaaacgtgctcgcgtcacctgtatttcaatgtgccgttggcaactca
gagaatgctctacagctcatcactattctgaagaagctctgcaacagcccttcactgctt
tccccaagaaatgtagacgaaaaacccagcgaaacaatcgcagctctactatcctctcta
cctccgaacctcctacgacacttttctccatcctccagcgctaaaatccgagtcctagac
caactactacacatcctgcatacctcaacttcagagaaagtcgttctcgtttcaaactac
acatccacgctcaatctgttagctacgctcctaacctcattatcacttccatttctacga
ctagatggctcgactccagcgcaaaaaagacaatccctagtcgaagacttcaaccgcttc
ccaacaaaccgctgcttcgcattcctcctatctgctaaggcaggaggcacggggctgaat
ctaataggcgccagccgcctcatcttattcgacgtggactggaacccagccaccgacatc
caagccatggccagaatccaccgcgacgggcaaaaacgacactgtcgaatataccgcatc
ctactgaagggcagcttggaagagaagatctggcaacgccaagtgaccaagctcggactc
gcagatagcgtcatggaacacaaggataacgctgcccagttctctcgagatgaactaaaa
gacctcttccgtctcgaccaggatagcaaatgtcaaacgcacgagcttctaggctgtgat
tgtgggggcaggggacaaaatgtgtcaacctcggactctcacgctggctccccggcagac
ggacaaggcaatgtattggattcagatgattcagaggaagtggaagaggacttcccggac
gttctgaccctcattaaagcttccaagctggacatgaagaagcaagagcgcatgattgag
gcgactcgcggggcacgccgtgggggtagaacgaccaaaagcactgatggcaccaaatct
gacaagcaaaaggataagatgcagcagtcgctgtctcaatactcccatatcgatccctgt
cacctaacaaccacaactgatgatacgcaagatatccaacaagttattgatgacgacgtg
cttctctctatgttaaaagaagaggataataggataagtttcgttttcaagaaatctagc
gtggcgttggcaaaggacacggattcgtcgatgccggttgttttatcggactaa

DBGET integrated database retrieval system