KEGG   Aspergillus oryzae: AOR_1_2280174Help
Entry
AOR_1_2280174     CDS       T01018                                 

Gene name
AO090005001315
Definition
tryptophan synthase
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
aor  Aspergillus oryzae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AOR_1_2280174 (AO090005001315)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AOR_1_2280174 (AO090005001315)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AOR_1_2280174 (AO090005001315)
Enzymes [BR:aor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AOR_1_2280174 (AO090005001315)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 692 aa AA seqDB search
MEHLKQTFAQCQQEGRPALVTYVTAGFPTAEETPDIMLGMQAGGADIIELGLPFTDPIAD
GPTIQKSNLKALKNGVTITSMLEMVREARRKGLKTPVLFMGYYNPLLRYGESQILADCKD
AGVNGFIIVDLPPEDAIRFRNGCTKMGLSYVPLIAPSTTEERMKALCSMADSFIYLVSRM
GVTGATGTLNTELPALIQRVKSLSGNVPVAVGFGISTREHFLSVTSIADGAVIGSQVINI
LADAPAGQAAQAVEDYCSKITQRKVSADASTTISGTTEAKAVALTDDAEAAVADGPGRFG
IFGGQYAPEALTTCLAELEAGFQAALDDPTFWEEYRSYYPYMGRPSSLHQATRLTEHIGG
ANIWLKREDLNHTGSHKINNALGQILIARRLGKTEIIAETGAGQHGVATATVCAKFGIKC
TIYMGAEDVRRQALNVFRIRLLGATVIPVESGSRTLRDAVNEAFRAWIVRLDTTHYIIGS
AIGPHPFPTMVRTFQSVIGNETKAQMQELGKSPDAVVACVGGGSNSVGMFYPFSKDLSVQ
LVGVEAAGDGLDTDRHSATLTGGSVGVLHGVRTYILQDEHGQISDTHSISAGLDYPGVGP
ELAHWKESKRATFLSATDAQAFEGFRLLSQLEGIIPALETSHAVWGAIQTAKKLGPGKDL
VLCLSGRGDKDVQSVADGLPTIGPQIGWDLRF
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctcaaacaaacatttgcccaatgtcaacaagaaggccgtccagcgctggtc
acgtatgtgacggccggattccccacggcggaggaaaccccggacatcatgctgggcatg
caggccggaggagccgacattattgagctgggtctcccattcaccgaccctatcgcagat
ggtcctaccatccagaaatcgaatctgaaggccctcaaaaatggggtcaccattacctcc
atgttggagatggtgcgggaggcccgccggaaaggactcaagacccccgtcctcttcatg
ggctattacaacccccttttacgctatggggagtcccaaatcctggccgattgcaaggat
gccggagtcaatggtttcattattgttgatttgccaccagaagacgcgattcgcttccgc
aatggctgtaccaagatgggtctctcctacgtcccactgatcgctccttccactacagaa
gagcgcatgaaggctctctgcagtatggcggattctttcatttatcttgtgtcccgtatg
ggcgtcaccggtgctacggggaccctcaacacagagcttccggcgctcatccagcgcgtc
aagagcctctccggcaatgtccccgtcgcagttggatttggaatcagcacgcgggagcat
tttctaagcgtgacctccatcgccgacggtgctgtcattggtagtcaagtgatcaacatc
ctggctgacgccccagccgggcaggccgctcaggcagttgaggactactgttcaaagatc
acacaaaggaaagtctctgcagatgcatcgactacaatcagcgggacaaccgaagcaaag
gcggtcgccctaaccgatgacgcagaggcagccgtggccgatggaccaggacggttcggt
attttcggtggtcaatatgcccccgaggccctgacaacgtgtctcgctgaactcgaggcc
ggtttccaggcagctctcgatgacccgaccttttgggaggaatatcggtcgtactatcct
tacatgggccgtccatcgagccttcaccaagcgacacgcctgactgagcacatcggtggt
gcaaacatctggctaaaacgggaagacctgaaccacaccggatctcacaagattaataat
gccttgggtcagatactcatcgctcgtcggttaggtaagacggagattatcgctgaaacg
ggcgccggtcaacatggtgtcgcgactgccaccgtatgtgctaaatttggcataaaatgt
actatctacatgggtgcggaggatgtccgtcgacaggccttgaatgtattccggatccgc
ttgctaggcgccacggtgatccccgtcgaatcgggatcgcgtaccctccgtgatgccgta
aatgaagccttccgcgcgtggattgtccgtctggataccacccactatattatcgggtct
gccattgggccccatcccttccctactatggtcaggactttccagagtgtgatcggtaat
gaaaccaaggctcagatgcaagagctgggcaagagtccggatgccgttgttgcctgtgtt
ggtggaggatctaattctgttggcatgttctaccccttttccaaggatctctctgtccag
ctggttggtgtagaagccgccggagatgggttagacacggaccgacactccgccacactg
actggaggctctgtaggcgtgctgcatggcgttcgcacatatatcctacaggacgagcac
ggccagatctccgacactcattccatttccgccgggctggattaccccggagttggaccg
gaactggcccactggaaggaaagtaagcgggcaacattcctgtccgctactgatgcccag
gcctttgagggcttccgcctcctgagccagttggaaggcattatccctgcgttggaaact
tctcacgctgtgtggggtgctattcagacagccaaaaagctgggacctggcaaggacctc
gtcttgtgtttgagtggtcgcggagataaggacgtgcagagcgtggctgatggattgccc
acgattggaccccagattggatgggacttgcggttctaa

DBGET integrated database retrieval system