KEGG   Aspergillus oryzae: AOR_1_2280174Help
Entry
AOR_1_2280174     CDS       T01018                                 

Gene name
AO090005001315
Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
aor  Aspergillus oryzae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AOR_1_2280174 (AO090005001315)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AOR_1_2280174 (AO090005001315)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AOR_1_2280174 (AO090005001315)
Enzymes [BR:aor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AOR_1_2280174 (AO090005001315)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 692 aa AA seqDB search
MEHLKQTFAQCQQEGRPALVTYVTAGFPTAEETPDIMLGMQAGGADIIELGLPFTDPIAD
GPTIQKSNLKALKNGVTITSMLEMVREARRKGLKTPVLFMGYYNPLLRYGESQILADCKD
AGVNGFIIVDLPPEDAIRFRNGCTKMGLSYVPLIAPSTTEERMKALCSMADSFIYLVSRM
GVTGATGTLNTELPALIQRVKSLSGNVPVAVGFGISTREHFLSVTSIADGAVIGSQVINI
LADAPAGQAAQAVEDYCSKITQRKVSADASTTISGTTEAKAVALTDDAEAAVADGPGRFG
IFGGQYAPEALTTCLAELEAGFQAALDDPTFWEEYRSYYPYMGRPSSLHQATRLTEHIGG
ANIWLKREDLNHTGSHKINNALGQILIARRLGKTEIIAETGAGQHGVATATVCAKFGIKC
TIYMGAEDVRRQALNVFRIRLLGATVIPVESGSRTLRDAVNEAFRAWIVRLDTTHYIIGS
AIGPHPFPTMVRTFQSVIGNETKAQMQELGKSPDAVVACVGGGSNSVGMFYPFSKDLSVQ
LVGVEAAGDGLDTDRHSATLTGGSVGVLHGVRTYILQDEHGQISDTHSISAGLDYPGVGP
ELAHWKESKRATFLSATDAQAFEGFRLLSQLEGIIPALETSHAVWGAIQTAKKLGPGKDL
VLCLSGRGDKDVQSVADGLPTIGPQIGWDLRF
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctcaaacaaacatttgcccaatgtcaacaagaaggccgtccagcgctggtc
acgtatgtgacggccggattccccacggcggaggaaaccccggacatcatgctgggcatg
caggccggaggagccgacattattgagctgggtctcccattcaccgaccctatcgcagat
ggtcctaccatccagaaatcgaatctgaaggccctcaaaaatggggtcaccattacctcc
atgttggagatggtgcgggaggcccgccggaaaggactcaagacccccgtcctcttcatg
ggctattacaacccccttttacgctatggggagtcccaaatcctggccgattgcaaggat
gccggagtcaatggtttcattattgttgatttgccaccagaagacgcgattcgcttccgc
aatggctgtaccaagatgggtctctcctacgtcccactgatcgctccttccactacagaa
gagcgcatgaaggctctctgcagtatggcggattctttcatttatcttgtgtcccgtatg
ggcgtcaccggtgctacggggaccctcaacacagagcttccggcgctcatccagcgcgtc
aagagcctctccggcaatgtccccgtcgcagttggatttggaatcagcacgcgggagcat
tttctaagcgtgacctccatcgccgacggtgctgtcattggtagtcaagtgatcaacatc
ctggctgacgccccagccgggcaggccgctcaggcagttgaggactactgttcaaagatc
acacaaaggaaagtctctgcagatgcatcgactacaatcagcgggacaaccgaagcaaag
gcggtcgccctaaccgatgacgcagaggcagccgtggccgatggaccaggacggttcggt
attttcggtggtcaatatgcccccgaggccctgacaacgtgtctcgctgaactcgaggcc
ggtttccaggcagctctcgatgacccgaccttttgggaggaatatcggtcgtactatcct
tacatgggccgtccatcgagccttcaccaagcgacacgcctgactgagcacatcggtggt
gcaaacatctggctaaaacgggaagacctgaaccacaccggatctcacaagattaataat
gccttgggtcagatactcatcgctcgtcggttaggtaagacggagattatcgctgaaacg
ggcgccggtcaacatggtgtcgcgactgccaccgtatgtgctaaatttggcataaaatgt
actatctacatgggtgcggaggatgtccgtcgacaggccttgaatgtattccggatccgc
ttgctaggcgccacggtgatccccgtcgaatcgggatcgcgtaccctccgtgatgccgta
aatgaagccttccgcgcgtggattgtccgtctggataccacccactatattatcgggtct
gccattgggccccatcccttccctactatggtcaggactttccagagtgtgatcggtaat
gaaaccaaggctcagatgcaagagctgggcaagagtccggatgccgttgttgcctgtgtt
ggtggaggatctaattctgttggcatgttctaccccttttccaaggatctctctgtccag
ctggttggtgtagaagccgccggagatgggttagacacggaccgacactccgccacactg
actggaggctctgtaggcgtgctgcatggcgttcgcacatatatcctacaggacgagcac
ggccagatctccgacactcattccatttccgccgggctggattaccccggagttggaccg
gaactggcccactggaaggaaagtaagcgggcaacattcctgtccgctactgatgcccag
gcctttgagggcttccgcctcctgagccagttggaaggcattatccctgcgttggaaact
tctcacgctgtgtggggtgctattcagacagccaaaaagctgggacctggcaaggacctc
gtcttgtgtttgagtggtcgcggagataaggacgtgcagagcgtggctgatggattgccc
acgattggaccccagattggatgggacttgcggttctaa

DBGET integrated database retrieval system