KEGG   Aspergillus oryzae: AOR_1_2290154Help
Entry
AOR_1_2290154     CDS       T01018                                 

Gene name
AO090003001305
Definition
alpha-galactosidase B
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aor  Aspergillus oryzae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AOR_1_2290154 (AO090003001305)
  Lipid metabolism
   00561 Glycerolipid metabolism
    AOR_1_2290154 (AO090003001305)
   00600 Sphingolipid metabolism
    AOR_1_2290154 (AO090003001305)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    AOR_1_2290154 (AO090003001305)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AOR_1_2290154 (AO090003001305)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 442 aa AA seqDB search
MQRYISLSVSLSLLSGANALVRPDGVGRLPALGWNTWNAFGCDIDASKVLTAAEETINLG
LKDAGYEYINIDDCWSVKSGRDPNTKRIIPDSAKFPDGISGVASKIHDLGLKVGIYSSAG
TETCAGYPASLGYEKIDAESFAEWGIDYLKYDNCGVPTNWTDTYTHCVPDNSNGSKFPNG
TCPDISNPAPTAYDWSSSNTAQRYNAMRDALLGVNRTILYSLCEWGQADVNTWGNGTGNS
WRTTGDITPDWSRIVEIANENSFLMNYADFWGYPDPDMLEVGNGNLTLEENRAHFALWAA
MKSPLIIGTALDSINEEHLAILKNKPLLSFHQDPVIGRPAYPYKWGYNPDWTFDPAHPAE
YWSGPSSTLGGTLVLMFNSEDSAKHRTAVWSEIPELKDSAEKGSGYRVTEIWTGEDLGCV
KDQYDVELQSHDIAALVVGESC
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgttacatttctttatccgtgtcgctgtctttgctttccggggctaatgctctg
gtccgccctgatggtgtgggaagactacccgcgttgggttggaacacctggaatgcattt
ggatgtgacatcgatgcctccaaggtcctgactgccgcggaagaaacaataaacctgggc
ttgaaagatgcaggttatgaatacatcaatatcgatgattgctggtccgtcaagagtggc
cgagatcctaatacaaaacgcatcattccggactcagccaagtttccggatggaatctca
ggtgtcgcttctaagattcacgacttgggtctgaaggtcggcatttatagcagcgccggt
acggaaacctgcgctggctatcctgctagtctgggatatgagaaaatagacgccgagagc
tttgctgaatggggcattgattatctgaaatacgacaactgcggcgtacctactaactgg
accgatacatatacccactgtgtgccagacaacagtaatgggtctaagttccccaacggc
acttgtccggatatatctaacccagcaccgacggcgtacgactggagcagctcgaacact
gctcaaagatacaacgctatgcgcgatgccttactgggtgtcaatcggaccattctctat
tcgttgtgtgaatggggccaggcagacgtgaacacatggggcaacgggacaggaaactct
tggagaacaacgggtgatattacacccgactggagccggattgtcgagattgccaacgag
aactcgttcctcatgaactatgccgatttctggggatatccagatcctgacatgttggaa
gtggggaatggaaacctgactctcgaagagaatagagctcactttgctctatgggcagcg
atgaaatcgcctctgatcatcggcactgctctcgattcaatcaatgaggaacaccttgct
attctgaagaataaacccttgctgtccttccatcaagatccggtcatcggtcggcctgcg
tatccttataaatggggatacaacccagactggacattcgatccagcacatccagcggaa
tattggtccgggccatcctcgactctgggtggaaccctggtcttgatgttcaactcggaa
gacagtgccaaacatcggactgccgtgtggagcgagatccctgagctgaaggattccgcc
gagaagggcagtggatatcgggtaactgaaatttggacgggtgaagacctgggctgtgtg
aaggatcagtatgacgtggagttgcagagtcatgatattgctgctctggtggtgggagaa
tcatgctga

DBGET integrated database retrieval system