KEGG   Aspergillus oryzae: AOR_1_2362154Help
Entry
AOR_1_2362154     CDS       T01018                                 

Gene name
AO090003001342
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aor  Aspergillus oryzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AOR_1_2362154 (AO090003001342)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AOR_1_2362154 (AO090003001342)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 569 aa AA seqDB search
MQPLRLLALTAILKGAWALSANCTGSFDAISASDFVANINPGWNLGNSLDATPNEDSWNN
PTVQESTFDYVKAAGFKSVRLPVTWTHHFTSESPDWTVDPKWLQRVSDVIDMITSRGLYT
IVNVHHDSWEWADVTKSDANITQIEQKFEKLWYQIGTKLACKSSMVAFETINEPPCNTAE
DGAKINKFNEIFLRAINRAGGFNAKRVVNLVGGGMDSVKTSQWFKTPANITNPWALQFHF
YSPYDFIFSAWGKTIWGSDSDKSELDSTLGLLRGNFTDVPIVLGEFDASPTNTEPAARWK
YHDYLIRSTKKYNMSPIIWDNGLDHLDRSSGIWRDPVSIEIITNGNETNSLPDSTVDTSA
PSQSSSAYIYHKVGTEVTDQTLPFIFNDNTLVSIQDSKGTTLKADTDYTVSGSNITFPAS
FLSTYYSETSEPGLLPNFTLKFSSGASPVVQLVQWDTPTLSKTSAAASSISGSDLSIPIT
WKGLPKLATVKALLNNGTYLVDDFTQWFGPFGEARTTYSNQWNWDDKNVILTQATVEAVV
AAGQDTVFTFEFFPRVDTTTNTVNFTLTV
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccattacggcttttggctctcacagccattcttaagggcgcctgggccctcagt
gccaattgtacagggtcctttgacgccatctcggcctctgatttcgtcgcaaatatcaat
ccagggtggaatttgggaaacagtctcgatgctactcccaatgaagattcttggaataac
cccactgttcaagaatcgacctttgactatgtcaaggcagctggttttaaaagtgttcgc
cttccagttacttggacacatcacttcactagtgaatctcctgactggaccgttgatcct
aaatggctgcagagagtttctgatgttattgacatgatcacgtctcgtggtctgtacact
attgtcaatgtccatcacgattcctgggaatgggcggatgtcactaaatctgatgcaaac
atcacccaaattgaacagaaatttgagaaactttggtatcagattggtactaagttggct
tgcaagtcaagcatggtcgctttcgaaaccatcaatgaaccaccttgcaatactgctgaa
gatggtgccaagatcaataaattcaatgaaattttcctcagagcaatcaatcgtgccggg
ggcttcaatgcaaagcgagtcgtcaacctggtaggtggaggaatggacagtgtgaaaact
tcacagtggttcaagacccccgccaatatcacaaatccatgggctcttcagttccatttc
tatagtccttacgactttatcttcagcgcatggggcaagactatatggggctcggactca
gataagagtgagcttgacagcactctcggccttcttcgaggcaacttcaccgatgttcct
atagtccttggagaattcgatgcctctccgaccaacactgaacctgcagcacgctggaag
tatcacgactacctcattcgctccacgaagaagtacaacatgagccctatcatctgggac
aacggacttgatcacctggaccgctcatcaggcatttggcgcgacccagtgtcaatcgag
atcatcaccaatgggaatgagaccaacagtcttcccgacagcaccgtagacacctctgcg
ccaagccagtcgtcttcggcatacatttaccacaaagtgggaacagaagtcactgatcag
actctccccttcatatttaacgacaacaccctcgtctctatccaagactcaaagggcacc
accctaaaggcagacacagattataccgtctccggttccaacatcacattccctgcctcg
ttcctctcaacttactactcggaaaccagcgagccaggcctcctccccaacttcaccctc
aaattctcatcaggcgcatcccccgtcgtccaactcgtccaatgggacaccccgacactc
tcaaagacctccgctgctgcctcatctatctccggatccgacctttccatccccatcaca
tggaaaggacttcctaaactcgccaccgtaaaggccctcctcaacaacggcacatactta
gttgatgacttcacccaatggttcggaccttttggcgaagccagaacaacatacagcaac
caatggaactgggatgacaagaatgtgattctcacacaggctacggttgaggctgttgtt
gctgcgggacaggatacggtctttacgttcgagttctttccacgcgttgacacaaccaca
aatacggtcaactttactttgactgtttga

  All links  
No link information was found.   
DBGET integrated database retrieval system