KEGG   Aspergillus oryzae: AOR_1_2420174Help
Entry
AOR_1_2420174     CDS       T01018                                 

Gene name
AO090005001395
Definition
endosome-associated ubiquitin isopeptidase (AmsH)
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
aor  Aspergillus oryzae
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:aor04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 554 aa AA seqDB search
MASHMPPATGAGASAPRKVEEITQMAQNYDYNPSIPLRYWLRTAATLLREARIYEREGHD
EQAYFLLFRHAQLVLVNLAKHSEAKDEQNRKALMEAEKEVSRNLEKLEILRPRINKRHKR
YTELMNDRQARSPPLGTNHTAPNQQQPQDPALVGVAEPLEAGENRDLAVKLARTEIHRRA
TARKAVRQAGITPQEEQRRRTAGIWGDWENALDKNGPETDNDLSRRIQNVRINMDHAHDA
DRQKKTTESTTRPLTASSSTSTYKYPTVPRQKALDIAPPVTKETKDATMSLQAAPVRPPK
ERFEPLQPVVLDGPSPPPRPDKISTPLTSAAQTQAPAPPAKVKPVADGGDGRSNLDPSSF
TFKPSAYLENGTPLRTVFLPPELRSTFLSLAASNTRRNLETCGILCGTLISNALFISRLL
IPEQTSTSDTCETVNETAIFEYCDSEDLMILGWIHTHPTQTCFMSSRDLHTHSGYQVMLP
ESIAIVCAPSKTPDWGVFRLTDPPGLKTVLNCTQPGLFHPHAETNTYTDALRPGHVFEAK
GLEFETVDLRPNGS
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgcatatgccgccggccacaggcgcgggggcctcagcccctcgaaaggtcgag
gaaatcacccaaatggcgcagaactatgattacaacccttcgattcctctgcggtattgg
ttaagaaccgcagcgactctactgagagaggctcgtatatacgaacgagaggggcacgat
gaacaagcgtacttccttctatttcgccatgctcagttggtgctggtaaacctggcaaag
cattcggaagccaaagatgagcagaatcggaaagctctgatggaagcagagaaggaagtt
agcaggaatcttgaaaagttggagattctcagacctcgaatcaataaacgacataaacgc
tatacagagttgatgaatgatcgtcaagctcgaagcccacctttaggaacgaaccacacc
gcaccgaaccagcagcagccccaggatcccgcattagtaggtgttgccgagcctctggag
gctggcgagaaccgagacctggcggtcaaactagcgaggacggaaatacaccggagggct
acggccaggaaagctgtacgtcaagctgggataacaccccaagaggagcagcgccggcgc
acggcaggtatctggggcgactgggagaacgctctggacaagaatggcccagagacggac
aatgacttgagtcgacggattcaaaatgtgaggatcaacatggaccacgcgcacgatgcg
gaccgtcaaaagaagacaacagaatccacgacgcggccgttgactgcaagttcctctacg
tccacgtataagtacccaacagtgcctcgtcagaaggcgctggatattgcgccccccgtg
accaaagaaacgaaagatgcgacgatgtcccttcaagcagccccagtgcggcctcccaaa
gaacgatttgagcctctccagccggtcgtcttagatggtccatcgccgccaccaagaccg
gacaagatctccacgcccctgacatccgcagctcaaacacaagctccagctcctccggcg
aaagtaaaaccagtcgcagatggtggggatggccggtcaaacctggacccttctagcttc
accttcaaaccgtccgcctacctggagaatggcacccctctccggacggttttcctgccc
cccgagctacggtcaacgttcctttcgctggccgcttcgaacacacgacgcaacctggaa
acatgtggtatactttgtgggactttaatatccaacgctctgttcatctcccgacttctc
atccccgagcaaacttccacatcggacacttgtgaaacggtgaacgagactgccatattt
gagtactgtgactcggaggatttgatgatcctcggctggattcatacccacccgacccaa
acttgcttcatgagctctagagacctgcatactcactctggataccaagtgatgcttcct
gagagcattgcaatcgtctgcgctccgagcaaaacgccagactggggcgttttccggttg
actgacccgcccgggctcaagacagtcctcaactgtacgcagcccggtttgtttcaccca
cacgccgagaccaacacctacaccgatgcgctacgacccgggcatgtgttcgaagccaag
ggcctcgaattcgagacggtggatctccgccctaacggatcctaa

DBGET integrated database retrieval system