KEGG   Aspergillus oryzae: AOR_1_2420174Help
Entry
AOR_1_2420174     CDS       T01018                                 

Gene name
AO090005001395
Definition
endosome-associated ubiquitin isopeptidase (AmsH)
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
aor  Aspergillus oryzae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aor00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AOR_1_2420174 (AO090005001395)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AOR_1_2420174 (AO090005001395)
Peptidases [BR:aor01002]
 Metallo Peptidases
  Family M67
   AOR_1_2420174 (AO090005001395)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 554 aa AA seqDB search
MASHMPPATGAGASAPRKVEEITQMAQNYDYNPSIPLRYWLRTAATLLREARIYEREGHD
EQAYFLLFRHAQLVLVNLAKHSEAKDEQNRKALMEAEKEVSRNLEKLEILRPRINKRHKR
YTELMNDRQARSPPLGTNHTAPNQQQPQDPALVGVAEPLEAGENRDLAVKLARTEIHRRA
TARKAVRQAGITPQEEQRRRTAGIWGDWENALDKNGPETDNDLSRRIQNVRINMDHAHDA
DRQKKTTESTTRPLTASSSTSTYKYPTVPRQKALDIAPPVTKETKDATMSLQAAPVRPPK
ERFEPLQPVVLDGPSPPPRPDKISTPLTSAAQTQAPAPPAKVKPVADGGDGRSNLDPSSF
TFKPSAYLENGTPLRTVFLPPELRSTFLSLAASNTRRNLETCGILCGTLISNALFISRLL
IPEQTSTSDTCETVNETAIFEYCDSEDLMILGWIHTHPTQTCFMSSRDLHTHSGYQVMLP
ESIAIVCAPSKTPDWGVFRLTDPPGLKTVLNCTQPGLFHPHAETNTYTDALRPGHVFEAK
GLEFETVDLRPNGS
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgcatatgccgccggccacaggcgcgggggcctcagcccctcgaaaggtcgag
gaaatcacccaaatggcgcagaactatgattacaacccttcgattcctctgcggtattgg
ttaagaaccgcagcgactctactgagagaggctcgtatatacgaacgagaggggcacgat
gaacaagcgtacttccttctatttcgccatgctcagttggtgctggtaaacctggcaaag
cattcggaagccaaagatgagcagaatcggaaagctctgatggaagcagagaaggaagtt
agcaggaatcttgaaaagttggagattctcagacctcgaatcaataaacgacataaacgc
tatacagagttgatgaatgatcgtcaagctcgaagcccacctttaggaacgaaccacacc
gcaccgaaccagcagcagccccaggatcccgcattagtaggtgttgccgagcctctggag
gctggcgagaaccgagacctggcggtcaaactagcgaggacggaaatacaccggagggct
acggccaggaaagctgtacgtcaagctgggataacaccccaagaggagcagcgccggcgc
acggcaggtatctggggcgactgggagaacgctctggacaagaatggcccagagacggac
aatgacttgagtcgacggattcaaaatgtgaggatcaacatggaccacgcgcacgatgcg
gaccgtcaaaagaagacaacagaatccacgacgcggccgttgactgcaagttcctctacg
tccacgtataagtacccaacagtgcctcgtcagaaggcgctggatattgcgccccccgtg
accaaagaaacgaaagatgcgacgatgtcccttcaagcagccccagtgcggcctcccaaa
gaacgatttgagcctctccagccggtcgtcttagatggtccatcgccgccaccaagaccg
gacaagatctccacgcccctgacatccgcagctcaaacacaagctccagctcctccggcg
aaagtaaaaccagtcgcagatggtggggatggccggtcaaacctggacccttctagcttc
accttcaaaccgtccgcctacctggagaatggcacccctctccggacggttttcctgccc
cccgagctacggtcaacgttcctttcgctggccgcttcgaacacacgacgcaacctggaa
acatgtggtatactttgtgggactttaatatccaacgctctgttcatctcccgacttctc
atccccgagcaaacttccacatcggacacttgtgaaacggtgaacgagactgccatattt
gagtactgtgactcggaggatttgatgatcctcggctggattcatacccacccgacccaa
acttgcttcatgagctctagagacctgcatactcactctggataccaagtgatgcttcct
gagagcattgcaatcgtctgcgctccgagcaaaacgccagactggggcgttttccggttg
actgacccgcccgggctcaagacagtcctcaactgtacgcagcccggtttgtttcaccca
cacgccgagaccaacacctacaccgatgcgctacgacccgggcatgtgttcgaagccaag
ggcctcgaattcgagacggtggatctccgccctaacggatcctaa

DBGET integrated database retrieval system