KEGG   Aspergillus oryzae: AOR_1_2444154Help
Entry
AOR_1_2444154     CDS       T01018                                 

Gene name
AO090003001390
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aor  Aspergillus oryzae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AOR_1_2444154 (AO090003001390)
   01230 Biosynthesis of amino acids
    AOR_1_2444154 (AO090003001390)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOR_1_2444154 (AO090003001390)
   00030 Pentose phosphate pathway
    AOR_1_2444154 (AO090003001390)
   00051 Fructose and mannose metabolism
    AOR_1_2444154 (AO090003001390)
   00052 Galactose metabolism
    AOR_1_2444154 (AO090003001390)
  Energy metabolism
   00680 Methane metabolism
    AOR_1_2444154 (AO090003001390)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AOR_1_2444154 (AO090003001390)
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AOR_1_2444154 (AO090003001390)
Protein phosphatases and associated proteins [BR:aor01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AOR_1_2444154 (AO090003001390)
Messenger RNA biogenesis [BR:aor03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AOR_1_2444154 (AO090003001390)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 786 aa AA seqDB search
MMATTHAPAEPPKRRRIGVLTSGGDAPGMNGAVRAVVRMAIYSGCEAYAVYEGYEGLVHG
GDMIRQVHWEDVRGWLSRGGTLIGSARSMAFRERAGRLKAAKNMIVRGIDALVVCGGDGS
LTGADLFRSEWPGLLEELVKTGELTEEQIVPYKVLNIVGLVGSIDNDMSGTDATIGCYSS
LTRICDAVDDVFDTAYSHQRGFVIEVMGRHCGWLALMSAISTGADWLFIPEMPPREGWED
DMCDIITKNRQERGKRRTIVIVAEGAHDRQLNKITSSKIKDILTNRLDLDTRVTVLGHTQ
RGGAACAYDRTLSTLQGVEAVRAVLDMTPESPSPVITVRENKLLRTPLMDAVKATKEVAD
LIHERKFDEAMHLRDSEFKEYHFAYKNTATPDHPKLILPENKRMRIAIIHVGAPAGGMNQ
ATRAAVAYCQTRGHTALAVHNGFPGLCRHHADTPVSSVREVSWEEQDTWVNEGGSDIGTN
RSLPSEDFETTAKCFEKFKFDGLFVVGGFEAFTAVSQLRQAREKYPAFKIPMVVLPATIS
NNVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRVFVVETQGGKSGYVATTAGLAVGA
SAVYIPEEGIDIKMLARDIDFLRNNFAHDKGANRAGKIILRNETASSTYTTQVIADMIKE
EAKGRFESRAAVPGHFQQGGKPSPMDRIRALRMAIRCMQHIETFSGKSADEIAADELSAT
VIGVKGSQVLFSQMGGPNGLEATETDWARRRPKDEFWLDLQSTVNILSGRASFGEGKTGW
SCYENC
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgatggctacgacgcacgcccccgcggagcctcccaagcgccgccgtatcggtgtcttg
acctctggtggtgatgctcccggtatgaacggcgccgtccgggctgtcgttcggatggct
atttactccggatgtgaagcctatgccgtatacgaaggctacgagggtctggtccatggc
ggagatatgatccgtcaggtacactgggaagatgtccgtggctggctctccaggggtggt
accttaatcggttcagctcgtagcatggctttccgggaacgtgccggtcgtctgaaggcc
gctaagaacatgattgtccggggtattgatgccctggtggtttgcggtggtgatggaagt
ttgactggtgccgacctcttccgttctgaatggcctggcttgctggaagagctggtcaag
acgggcgaattgactgaggaacagattgtcccttacaaggtgttgaacattgttggtctg
gtgggctcgattgataacgacatgtccggcacagacgctaccatcggctgttattcctcc
cttacccgcatctgtgatgcggtcgacgacgttttcgataccgcttattcgcaccagaga
ggcttcgttattgaagtcatgggacgccattgtggctggctggccttgatgtcggctatc
agcactggcgccgactggcttttcatccccgagatgccaccccgcgagggctgggaagat
gacatgtgcgatatcatcaccaagaaccgtcaggaacgaggcaagcggagaacgattgtc
attgtggccgagggcgctcatgaccgccaactcaacaagatcacgagcagcaagattaag
gatattttgaccaaccgacttgatctggacactagggtgaccgtcctaggccacactcaa
cgaggaggagcagcatgtgcctatgaccgtaccctctcgaccctacagggcgtggaagcc
gtccgtgccgttttggatatgacacccgaatctccgtcccctgtcatcaccgtccgcgag
aacaagttgctgcgcacgccgttgatggatgcagtgaaggccaccaaggaagtcgccgac
ctcattcatgagcgcaagttcgatgaggctatgcatctgcgcgactctgaattcaaggag
taccatttcgcctacaagaacactgctacccccgaccaccccaagttgatcctcccagaa
aacaagcggatgcgcattgccattatacacgtcggtgcacctgccggaggtatgaaccaa
gccacccgtgctgccgtcgcctactgccagactcgtggacacacggcccttgccgttcac
aacggtttccccggcctctgccggcatcatgcagacacccccgttagctctgtgcgcgag
gtcagttgggaggagcaggacacctgggtcaacgaaggtggttcagacatcggaaccaac
cgaagcctgccgtccgaggacttcgagaccactgccaagtgttttgagaagtttaagttc
gatggtttgttcgtggttggtggtttcgaggctttcactgctgttagccaattgcgccag
gcccgcgagaaatatccagccttcaagatccccatggtggtcttgccggccaccatttca
aacaacgtcccgggtaccgaatactccctcggcagcgacacctgcttgaacactttgatc
gacttctgtgacgctatccgtcaatccgcgtcgtcctcccgccgccgtgtcttcgtcgtc
gaaacccagggtggtaagtccggttacgtcgctacgaccgctggtctcgcggtaggtgcc
tcggccgtctacatcccggaggaaggcatcgatatcaagatgctggcacgcgatatcgat
ttcctgcgcaacaacttcgctcacgacaagggtgccaaccgtgccggaaagatcatcctg
cgcaacgagaccgcttccagcacctacaccacacaagtcattgccgacatgatcaaggaa
gaagccaagggccgctttgagtcgcgtgcggcggtccctggtcacttccaacagggtggc
aagccctctccgatggaccgaatccgtgccctgcgcatggccatccgatgcatgcagcac
atcgaaaccttctccggcaagtccgccgacgagattgccgccgacgagctttctgcgacc
gtcatcggtgtcaagggatcccaggtactcttctcccagatgggcggtcccaacggcctg
gaagcgaccgagaccgactgggcccgtcgtcgcccgaaggacgaattctggctcgacttg
cagagcaccgtcaacattttgtccggtcgcgccagcttcggcgagggcaagacgggctgg
tcttgctacgaaaactgttaa

DBGET integrated database retrieval system