KEGG   Aspergillus oryzae: AOR_1_2550174Help
Entry
AOR_1_2550174     CDS       T01018                                 

Gene name
AO090005001468
Definition
checkpoint protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
aor  Aspergillus oryzae
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:aor00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AOR_1_2550174 (AO090005001468)
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AOR_1_2550174 (AO090005001468)
Protein kinases [BR:aor01001]
 Serine/threonine protein kinases: Other group
  TTK family
   AOR_1_2550174 (AO090005001468)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 830 aa AA seqDB search
MASTNSLSAAYTGSLHRQPSSRQMSRASVSRTGSRRTSPELQNSAALRSNGLSISKRYSA
GDSSDDEVPEPKFSASVKALLDEDGLDLSPRLHKNGQSNPSISTSQERRSRTASPNDGST
GSPAPRVVRISPGLTSGARFRREGSHVSGGEDADSEARGSSHDFVTPAPRHRSVRITGSR
SSTRSPASISPSQRRSADRSSVEEHDSASRLEDGRRVKYEDDYAPRLGTASVLRSRNGED
LGIHSSLRVKRVGRLTGTFLNGPARRGVLRRQSEENNDPDNYKEANPDGNYDNDDYHYKS
TTKSSSPKVSWATDPSPPQRSEGYRSYEAAGISATEGPFSRSSSPKSYGSHSKSTPGSSS
EASSSKPSSAKDQPVFKVPPPPTLPAARDQENEPPPTFKRVKQQGFNLLDKPEKLSVAHG
DEKKESMETPAGNSPRKILSTRSNNTPHRPAPPPPKMSVLETATATGGAATASSSRRKRN
QVSVNHKPFTRLDCIGRGGSSRVYRVMAENYKIFALKRVNLEDVDPVTLAGYKGEIDLLK
KLENLDRVVRLFDWELNSDKHTLSVLMEIGESDLEKILTYRLNAEDAVFDINFTRYYWKE
MLECVQAVHNYNIVHSDLKPANFLLVQGRLKLIDFGIANAIQDNTVNVHREQQVGTPNYM
SPEALIDSNASLGLPASVGKVMKLGKPSDVWSLGCILYKMVYGQPPFAKIAKYYERILAI
PNPNVKIDFPAFGVGGASIPPGLIRTLKGCLQRDQTLRPTVDQLLAQRDPFLYPEAQLEG
AVPVTQEMLNRILVNVVNHCKVRGIPKEEELAAWPAGFFAKIKAALEENA
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggcttctactaactccctctccgcagcatatacgggtagtctccatcgacagccgtca
tcccgacaaatgtcccgcgcctcggtctctcgcaccggctccaggcgcacgtcaccggaa
ttgcagaattcggccgcacttagaagcaatggactatcaatatctaagcgttactctgcc
ggcgatagctccgatgacgaggttccggaacccaaattcagtgcttccgtcaaagccttg
cttgatgaagatgggttagacctatcccctcgcctacacaaaaatggccaaagcaatcct
tcaatatcaacaagccaagagaggcgctcgcgcacagcatctcccaacgacgggtcgact
gggagcccggcgcctcgggtcgttcgcatttcacccggcttgaccagcggcgcaaggttt
cgaagagaaggatcgcatgtctcaggcggcgaggatgccgattctgaagcgaggggaagc
tcgcatgactttgttacgccagctccaaggcatcgcagtgttcgcatcactgggtcacgt
agtagcacgcgatcccccgcatccatatcgccctcccaaaggcgatcagctgataggagc
tctgttgaagagcatgacagcgcaagtcgccttgaagatggaaggagagtaaaatatgag
gatgattacgcaccacgtctgggcaccgcatcggtattgcggagtcggaatggagaagat
ctgggcattcatagttcgcttcgtgtgaagagggtaggaaggctcacaggaacatttctg
aatgggccagcgagaagaggcgtgctccggcggcaaagtgaggaaaacaatgatccagac
aattacaaagaggcgaaccctgacggaaactatgacaatgatgactatcattacaaaagc
acgacgaaatcatcatcacccaaagtatcttgggcaacagaccctagcccgccacaaaga
tccgaaggatatcgatcgtacgaagctgctggcatttcagcgactgagggccccttttcg
aggtcctcgtcaccgaagtcttacgggtcacactcgaagtcgacacctggctcatcatca
gaggcatcatcatccaaaccttcaagcgcgaaggatcaacccgtcttcaaagttccccct
ccgcccacactacctgcagctcgcgatcaagagaacgagcctccaccgaccttcaaacgg
gtgaaacaacagggctttaacttgcttgataaaccagaaaagctctcagtggctcatggg
gacgaaaagaaagaaagcatggaaacaccagctggaaactcacccagaaagatcctatcg
actcgaagcaacaataccccacatagaccggcccctcctcccccaaagatgtccgtactt
gagactgctacagcaacagggggcgcggctaccgcgtcctcatcccgcagaaagcgtaat
caagtatcggtcaatcacaaacccttcacgcggttagactgcattggccgaggcggaagt
tcgcgcgtgtaccgagtaatggctgagaactataagatctttgccctaaaacgagtgaat
ttggaggatgtcgatcccgtaacattggctggctacaagggagagattgatctactcaag
aaattggaaaacctggaccgtgtcgtacgcttgtttgactgggagttgaattccgacaaa
catacactcagtgttctcatggaaattggagagtctgacctagaaaaaatacttacatac
agactaaatgccgaggatgccgttttcgatatcaactttactcgatattactggaaggag
atgcttgagtgcgttcaagcagtccataactacaacattgtccattcggacctgaagccc
gcaaacttccttcttgtacaagggaggttgaaactgatcgactttggaatcgcgaacgcc
atccaggacaatacggtcaacgtacaccgtgaacagcaagttggtactccaaactatatg
tcaccagaagctttgattgattcgaacgcatcgctcggattgccggcaagcgtcggaaaa
gtgatgaagctcggtaagccgagcgatgtctggagtttgggttgtattctctataagatg
gtgtatggtcagcctccttttgcgaagattgctaaatactatgagcgcatcttggctatc
cccaatccaaatgtcaagattgatttccccgcctttggtgttggaggagcgtctattccc
ccgggactgatccgaacgttgaaggggtgcttgcagcgtgatcagacgttacgaccgacc
gtggatcaactcctggctcagagggacccattcttataccctgaggcgcaacttgaagga
gctgttcccgtcacccaggaaatgctcaacaggattttggtgaacgtagtaaatcactgc
aaagtgcgcggcatccccaaggaggaagaactcgcggcttggcctgctggattctttgca
aagatcaaggcagcattggaagagaacgcatga

DBGET integrated database retrieval system