KEGG   Aspergillus oryzae: AOR_1_2622174Help
Entry
AOR_1_2622174     CDS       T01018                                 

Definition
histone deacetylase HOS2
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AOR_1_2622174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 486 aa AA seqDB search
MARSAIVQEYAPPSSTPTITLDQKTIHERQQNGIARPKGYRVSWHANPAVEPHHFGQSHP
MKPWRLTLTKQLVMAYGMHHAMDLYLARSATYEEMAEFHKTDYLDFLRQVMPGDMENPEQ
GENIARFNFGDDCPIFDGLYNYCSLYAGGSIDAARKLCNNQSEIAINWSGGLHHAKKAEA
SGFCYVNDIVLGILQLLRLHPRVMYIDIDVHHGDGVEQAFWSTDRVLTVSFHKYDKDNFF
PGTGALDSTGPTHPLNPGAHHAVNVPLHDGIDDESYIRLFREVIGSCISTYQPGAIVLQC
GADSLGCDRLGCFNLNVAAHGACVAYVKTFGLPLLVVGGGGYTPRNVSRAWAHETSILID
AQDTIDPNIPETVAFRNHFGPDYSLFPPLSEMRKLENKNPRSYLSGLVQSIHEQLRYMQG
APSVQMSFIPPDILGLREDTEKEIEEQMAEQDEAREEREGGGSASKNSRRRELERGVGQR
GELFSA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcacgctctgccatcgtccaagaatacgcccctccctcgtccactcccaccatcact
ctcgaccaaaagaccatccatgaacgccaacaaaatgggatcgctcgccccaaaggctac
cgcgtctcctggcacgccaacccagctgtcgaaccgcaccatttcggtcaatcgcacccg
atgaaaccctggcgtctgacgctgaccaaacaactcgtcatggcctacggcatgcaccat
gcgatggacctgtatctcgctcgctcagcgacctacgaagaaatggccgagtttcacaaa
acagactacctcgatttcctccgccaggtcatgcccggcgatatggagaacccagagcaa
ggcgagaacattgcgcgcttcaacttcggcgatgactgccccatcttcgacggtctgtac
aactactgctcgctctacgctggcggctccatcgacgctgctcggaagctctgcaacaat
caatccgaaatcgcaattaactggtctggcggtcttcatcacgccaaaaaggccgaggcc
agcggcttctgctacgtgaacgacatcgtcctcggcatcctacagctcctccgtctgcac
ccgcgcgtcatgtacatcgacatcgacgtgcaccacggcgacggcgttgagcaagccttc
tggtccacggatcgcgtcctgaccgtctccttccacaaatacgacaaggataacttcttc
ccaggcaccggcgccctagacagcaccggaccaactcacccactgaacccaggcgcacac
cacgccgtcaacgtccccctccacgacggcatcgacgacgaatcctacatccgtcttttc
cgcgaagtcatcggctcctgcatctcaacctaccaacccggcgcaatcgttctccaatgc
ggcgccgactccctcggttgcgaccgcctcggctgcttcaacctcaacgtcgccgcccac
ggcgcctgcgtcgcctacgtcaaaaccttcggcctccccctcctcgttgtcggcggcggc
ggctacaccccccgcaacgtctcccgtgcttgggcccacgaaacctccatcctcatcgac
gcccaagataccatcgaccctaacatccccgaaactgtcgccttccgcaaccactttggc
ccagattactcgctgttcccgccattgagcgagatgcgcaagctcgagaataagaacccg
cgcagctatctatccggtcttgtccagtccattcatgagcagttgcgatatatgcagggg
gcacccagcgtgcagatgagttttattccgccggacattctgggtttgcgggaggatacg
gagaaggagattgaggagcagatggcagagcaggacgaggcgcgggaggaaagagaaggc
ggtgggtctgcgagtaagaatagtcgacgacgagagttggagaggggtgttgggcagagg
ggggaattgttttctgcttaa

DBGET integrated database retrieval system