KEGG   Aspergillus oryzae: AOR_1_264014Help
Entry
AOR_1_264014      CDS       T01018                                 

Gene name
AO090026000138
Definition
NADH-cytochrome b5 reductase 1
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
aor  Aspergillus oryzae
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AOR_1_264014 (AO090026000138)
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AOR_1_264014 (AO090026000138)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 292 aa AA seqDB search
MSAFASENLTSALLVVGTAIFAVLVGAKFLGGSGKPRKVLNPTEFQNFVLKEKNEISHNV
AIYRFALPRPTDILGLPIGQHISLAATIEGQPKEVVRSYTPISSDNEAGYFDLLVKAYPQ
GNISKYLTTLKIGDNMKVRGPKGAMVYTPNMCRHIGMIAGGTGITPMLQIIKAIIRNRPR
NGGNDTTQVDLIFANVNPEDILLKEELEQLVKEDDGFRVYYVLNNPPEGWTGGVGFVTPD
MIKERLPAPAQDIKIMLCGPPPMISAMKKATESLGYTKARPVSKLEDQVFCF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctttgcttcggagaacttgacctccgccctcctggtggttggcacagccatt
ttcgctgtcttggtcggcgcgaagtttctcggtggtagtggtaaacccagaaaggtcctg
aaccctaccgagttccagaactttgtcttgaaggagaagaatgagatctctcacaacgtc
gctatctatcgctttgccctgcctcgccccaccgacatcttgggtctgcccatcggtcaa
cacatctctctcgccgctaccattgaaggccagcccaaggaggttgtgcgctcttacacc
cccatctcctccgacaatgaggctggatactttgatctcctcgtcaaggcctaccctcag
ggtaacatttccaagtacctgaccaccctgaagatcggcgacaacatgaaggtgcgcggc
cccaagggtgccatggtgtacaccccgaacatgtgccgtcacattggtatgatcgccgga
ggaaccggtatcacccccatgctgcagatcatcaaggccatcatccgcaaccgcccccgc
aacggtggtaatgacaccacccaggtggacctgatctttgccaacgtcaaccccgaggat
atcctgctgaaggaagaactggagcagctcgtcaaggaggatgacggcttccgtgtctac
tatgtacttaacaacccccctgagggctggaccggtggtgttggattcgttactcctgac
atgatcaaggagcgcctccctgctccggcccaggacatcaagatcatgctgtgcggcccc
cctcccatgatcagcgccatgaagaaggcgaccgagtctcttggatacaccaaggctcgc
cctgtcagcaagctcgaggaccaggtgttctgcttctaa

DBGET integrated database retrieval system