KEGG   Aspergillus oryzae: AOR_1_2698174Help
Entry
AOR_1_2698174     CDS       T01018                                 

Gene name
AO090005001553
Definition
endo-beta-1,4-glucanase B
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aor  Aspergillus oryzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AOR_1_2698174 (AO090005001553)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AOR_1_2698174 (AO090005001553)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 333 aa AA seqDB search
MKFRNLFFAAVAGSAVAAPLAKEQKKRDSVFQWIGANESGAEFGENNLPGVWGTDYIFPD
VSAITTLIDKGMNIFRIQFKMERLVPDSMTGAYDEAYLQNLTTVVNAVTDAGVHAILDPH
NYGRFNGEIMSTPSDFQTFWKNLAGQFQSNSLVIFDTNNEYHDMDQELVLNLNQAAIDGI
REAGATEQYIFVEGNSYTGAWTWTDVNDNMKNLEDPQDKIVYQMHQYLDSDGSGTSETCV
SGTIGQERVTSATQWLKDNKKVGIIGEFAGGNNDQCKTAVKGMLDYLAENTDVWKGALWW
AAGPWWGDYMYSLEPPNGVAFTGMLDVLQAYLG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaattccgtaaccttttctttgctgccgtagctggctctgcggttgctgctcctctg
gctaaggagcaaaaaaagagggattcagttttccaatggatcggcgccaatgagtcgggt
gctgaattcggcgagaacaacctccctggcgtatggggtacagattatatcttcccggat
gtctcggccattaccaccttgattgataaggggatgaatatattccgtatccaattcaag
atggagagattggttccagactcaatgacgggggcatacgatgaggcctacctgcagaac
ttgaccacggtggtcaatgccgtcactgatgcgggtgtccatgctatcttggacccccat
aactatggcagattcaatggcgagatcatgtccactccatctgatttccaaacattctgg
aagaacttggcaggacagttccagagcaactctttggttatcttcgataccaacaatgaa
taccatgacatggaccaagagctggtcctgaacctcaaccaagccgccattgacgggatc
cgagaggctggcgccacggagcaatatatcttcgttgaaggtaactcgtacaccggggcc
tggacctggaccgatgtgaacgacaacatgaagaacttggaggatccccaggacaagatc
gtctatcagatgcaccagtatttggactcggatgggtctggtacttccgagacctgcgtg
tctggtaccattggccaggagcgtgtcaccagcgctactcaatggctcaaggacaacaag
aaggtcggtatcatcggtgagttcgcgggtggaaacaacgaccagtgcaaaactgccgtg
aagggaatgctggattatctggctgagaacaccgacgtgtggaagggtgcgctttggtgg
gcggccggtccatggtggggagattatatgtacagtttggagcctccaaacggagttgcg
ttcacgggaatgttggacgttctgcaggcatacctggggtag

DBGET integrated database retrieval system