KEGG   Aspergillus oryzae: AOR_1_276174Help
Entry
AOR_1_276174      CDS       T01018                                 

Gene name
AO090005000146
Definition
histidinol dehydrogenase 1
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
aor  Aspergillus oryzae
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AOR_1_276174 (AO090005000146)
  Amino acid metabolism
   00340 Histidine metabolism
    AOR_1_276174 (AO090005000146)
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     AOR_1_276174 (AO090005000146)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 448 aa AA seqDB search
MPARHLKSRSDNVAVSTTPQIDVSSVVKGVIDDVRQNGDAAVRKYSEKFDKWSPASFKLS
QADIDAAIAACPQQTIDDIKEVQKNVRAFAQAQRESLKDFEYEIQPGVVLGQKNLPINSV
GAYIPGGRYPLLASAHMTILTAKVAGVPHVVGCTPPIAGKVPHATIAAMHLAGADEIYLL
GGVQAIAAMAVGTGTMKKVDFIAGPGNAFVAEGKRQLFGEVGIDLFAGPTEILIVTDDTA
DPFTVATDILSQAEHGPDSPAVVITTSERVGRKAIEIINELLKHLSTGDVASVSWERFGE
VIVVDTIDEAWKLADEYASEHVQIFTKRPRDALDNMTAYGALFLGEKTCVSYGDKVIGTN
HVLPTKKAARYTGGLWVGKYLRTVTYQEVESSKASGELGRLCGRAARAENFEGHARSGDL
RAQKYLDDQYDWIKLYHDENPKAYRGNL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccgccatctgaaatccaggtcagacaacgtggccgtctccaccactccccaa
attgatgtcagttcagtcgtcaagggtgtgatagacgatgtccgacagaatggcgatgca
gccgtacgcaagtactctgagaagtttgacaagtggtcaccggcttcgttcaagctatcc
caggcggatattgatgccgcgatcgcggcctgtccccagcagaccatcgacgacattaag
gaggtccagaagaatgtgcgtgcatttgcacaagctcagcgcgagtctctgaaggacttt
gagtatgagattcaacctggcgttgttctgggccagaagaatcttcctattaactctgtc
ggcgcatatatccctggtggacgctatcctctgcttgcctccgcccacatgaccatctta
actgccaaagttgccggcgtgccacacgttgtgggttgcactccacccatcgctggcaag
gtacctcacgccacaattgcagccatgcaccttgctggagccgacgagatatatctcctt
ggtggtgttcaagcgatcgctgcaatggccgttggtaccgggacaatgaaaaaggtggat
ttcatcgcgggacccggaaatgctttcgtcgccgagggaaagagacagctctttggcgag
gtcgggattgacctcttcgccggaccgacagaaatcttgattgtgacagacgatacggcg
gatcctttcaccgtcgctactgacatcctctcccaggctgaacacggccctgactctccc
gctgtggtaatcactacgtcggaaagagtaggccggaaagccatcgagatcatcaatgaa
ctgctcaaacatctttcaactggggacgtggcaagtgtttcgtgggagcgattcggcgag
gtgattgttgttgacacaattgatgaagcttggaaattggcagatgaatacgccagtgaa
catgttcagatctttacgaaacggcctcgggatgcattggacaatatgacagcatatgga
gcgctcttcttgggtgagaagacgtgtgtttcttacggggataaggtgattggaaccaac
cacgtgctccctactaagaaagcagctagatataccggtggtctctgggttggaaagtat
ctcagaacagtgacatatcaggaggtggagagtagcaaggctagtggtgaactgggaagg
ctctgtggacgagcagctagagcagagaacttcgaaggccatgctcggtctggggattta
cgcgcacagaagtatctggatgatcagtatgattggatcaagctgtatcatgatgagaat
cccaaggcatatagaggaaatctgtga

DBGET integrated database retrieval system