KEGG   Aspergillus oryzae: AOR_1_2848174Help
Entry
AOR_1_2848174     CDS       T01018                                 

Gene name
AO090005001624
Definition
poly(A)+ RNA export protein
Orthology
K14298  
mRNA export factor
Organism
aor  Aspergillus oryzae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aor00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AOR_1_2848174 (AO090005001624)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 363 aa AA seqDB search
MSLFGSVGTTSTTAGQTNTTGDISKDVALNSPPEDSISDLQFSPASEHLAVASWDKKVRI
YEINDQGQSEGKALFEHEAPVLSCCWAPDGTKVVGAGADKAARMLDLAANATTPVQVAAH
DAPIKCCQMIPNPAGGTPLLVTGSWDKTVKYWDLRQSTPIATVECQERVYTMDVKNKLLV
VGTADRYINIINLDNPTKFYKTMQSPLKWQTRVVSCFTDATGFAVGSIEGRCAIQYVEDK
DSSSNFSFKCHRETPPNQRDINNIYSVNAISFHPVHGTFSTAGSDGTFHFWDKDAKHRLK
GYPSVGGTISSTAFNRNGNIFAYSVSYDWSKGYSANTQQLPNKVMLHPVAQEEVKPRPGT
RKR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcttcggttctgtcggcactacgtcgacaacagcgggccaaacaaacaccacc
ggcgacatatctaaagatgtcgctctcaattcgcctcctgaagatagcatttctgatctt
cagttttcccccgccagtgaacatcttgcggtagcttcttgggacaagaaagtccgcatt
tatgagatcaatgatcagggacagagtgaaggaaaagctctctttgagcatgaagctcca
gttttaagctgctgctgggcaccggatggaactaaagtagtaggcgctggtgccgataag
gctgcacgcatgctcgatctcgctgcaaatgctacgacccccgtccaggtcgcagctcac
gatgctccgatcaaatgctgccagatgattccgaatcctgctggaggtacacccctccta
gtgaccggctcgtgggacaagacagtcaaatactgggatctacggcaatcgaccccgatc
gccacggtagaatgtcaggagcgtgtctacaccatggatgtcaagaacaagctgctagtg
gttggaactgcagaccgatacattaacatcatcaatctcgacaatcccaccaaattctac
aaaactatgcaatcccctctcaagtggcagacgcgagtagtcagctgcttcacagatgct
acggggtttgctgttggcagtatcgagggccgctgtgctattcagtacgtggaggacaag
gactctagctcgaacttcagcttcaaatgtcatcgagagacacccccaaaccaacgcgac
atcaataacatctattccgtcaatgctatctctttccacccggttcatggcactttcagc
accgctggcagcgatggaacctttcacttctgggacaaagacgccaaacatcgcctaaag
ggatatccctcagtaggggggaccatctccagcaccgcattcaaccgcaatggcaatata
tttgcctactctgtgagctacgactggagcaaaggctactcggccaacacccaacagctt
cctaataaagtaatgcttcatccagttgctcaagaagaggtgaagcccaggcctggtacc
aggaagaggtaa

DBGET integrated database retrieval system