KEGG   Aspergillus oryzae: AOR_1_288164Help
Entry
AOR_1_288164      CDS       T01018                                 

Gene name
AO090001000167
Definition
7-dehydrosterol-delta 7-reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
aor  Aspergillus oryzae
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    AOR_1_288164 (AO090001000167)
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     AOR_1_288164 (AO090001000167)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 465 aa AA seqDB search
MAAAQLIDGLSGFASGKGHIQKTVITGQKALWGRRANVSGFSSLPSMLLMIGAPLLVLLI
SVALTHYDGSIARVLDDLYSHGALPFLMRYCPSLTTQGIIAYISWLVFQALLYQVLPGRI
VSGPPTPGGYSLPYKVNGLWSWFASLAVFIGLVKAGRLDPTFVAVHQGELIIIANIYGFL
ITAASVAKSHLLTQNTRDIRFSGSIIHDFLSGVELNPRLGKYWDLKLFQIGRVGMNSWVL
VDLSFAAMQYQKFGYLTNSMIVVNLLHALYVVDFFVNEDWYLSTIDIALDHFGFNLAWGS
AVWLPVVYTTQAHYLAYHPVQFSGLQCTLLLVAGITGYVIFRSANHQKYRTRQSNGTNLI
WGQKPSLIQATYQTADGSSHSSMLLHSGWWGLVRHPNYIGDLIFSFCTCAGCGFSHIVPW
TYFFFMASLLIHRALRDDARCSSKYGDRWSIYCKIVPWRLIPGIF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgcacagctcattgacgggctgtccggctttgcatccggaaaaggccatatt
cagaaaacagtgattaccggtcaaaaggctctctggggcaggcgagccaatgtttcgggc
ttttctagccttcctagtatgctgttgatgatcggggcgcctctcctcgtgctactgatc
tctgtggctctcacccactatgatggctcaatcgcaagagtgcttgatgacttgtattct
catggcgccctcccatttctcatgcgatattgtccatctttgaccacgcagggcataata
gcgtacatctcctggctggtctttcaagcattgttataccaagtcctcccagggagaatt
gtgtccggtccacccactcccgggggatattctttgccatataaagtcaatggattatgg
tcctggtttgcaagcctagctgtatttattggccttgtcaaagcaggcaggctggacccg
acctttgtcgcagtgcatcagggtgaacttattattattgccaacatatatggattcttg
atcacggctgcgtcggtggcaaagtcccatttattgacccagaacacgagggatattcga
tttagcggatccatcattcacgatttcctatctggagtggaacttaacccgcgcctgggc
aagtactgggacttgaaactttttcagattggacgtgttggtatgaacagctgggtactt
gttgacttatcctttgctgctatgcaataccagaaatttggctacctcacaaattctatg
atagtagttaatttgctacatgccttgtatgtggtcgactttttcgtcaatgaggactgg
tatctaagcacgatagatattgccctggaccacttcggtttcaacttggcatggggctcc
gccgtctggctcccagttgtttatactactcaagcacactatctggcttatcaccccgta
cagttttccgggttacaatgcacactacttctagtagccggaattacaggttatgtgata
ttccgttctgcaaatcatcaaaagtaccgcacgcgccagtcaaacggaaccaacttgatc
tggggccaaaaaccttcactcattcaagcaacttaccaaacagccgatggctcgtcgcat
tcgtctatgcttctacattccggttggtggggattggtccgtcatccgaactatatcgga
gatttgatcttctcgttttgcacttgtgctggatgtgggttttcacatatagtcccttgg
acatatttcttctttatggctagtctgcttattcatcgggctttgagagatgacgcccgt
tgctcgtcaaagtatggtgatcgatggagtatctactgtaagattgtgccgtggaggtta
attccggggatcttttga

DBGET integrated database retrieval system