KEGG   Aspergillus oryzae: AOR_1_2906174Help
Entry
AOR_1_2906174     CDS       T01018                                 

Gene name
AO090005001652
Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aor  Aspergillus oryzae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aor00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 375 aa AA seqDB search
MSFSNLVSDLAFRDSHDDRSSQISQVQSQATARSYTSTAATSVSISGDISSQLHSGYSHP
LSRSWQAERQLTKEMLIYPLFITDNPDEETPIPSLPGQYRRGLNRLVPFIKPLAHKGLRS
VILFGVPLHPSAKDALGTAADDPSGPVIQAIRLLRSRFPQLYIVTDVCLCEYTSHGHCGI
LREDGTLDNTQSVDRISDVALAYAAAGAHCVAPSDMNDGRVRAIKLKLIEAGMAHRVLLM
SYSAKFSGCLYGPFRDAAGSCPSFGDRRCYQLPPGGRGLARRAIQRDIGEGADIIMVKPA
SSYLDIIRDAKEIAKDIPIAAYQVSGEYAMIHAGAKAGVFDLKSMAFESTEGIIRAGAGI
IVSYFVPDFLDWLSK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtccttttctaatctcgtctctgacctcgccttcagagattctcatgatgaccgaagt
tctcagatatctcaggtacaatcgcaagccactgcacgatcgtatacaagcacagctgcc
acaagcgtcagcatatctggcgacatctcaagccagcttcattccggttacagccatcca
ctgagccgatcatggcaggctgaaagacagttgactaaagaaatgcttatttatcctctc
ttcatcaccgataatcccgatgaggagactcctatcccgtctctccctggacagtatcgt
cgaggattaaaccgtctagttcctttcatcaaaccacttgcccacaaggggctacgctca
gtcatcctgtttggcgtcccactacacccctctgcgaaggatgcactaggtaccgctgca
gacgatccatctggaccggtaattcaagctattcgcttgcttaggtcgcggtttcctcaa
ctttatatcgtgacagatgtgtgcctttgcgagtatacttcgcatggccactgtgggata
ctgcgagaagatgggactcttgataatacacagtctgtggatcggatttcggatgttgct
ctggcttatgctgccgccggagcccattgtgtcgctccgtctgatatgaatgatgggcga
gtgcgtgctataaaactgaagcttattgaagccgggatggcccaccgtgtcctactgatg
tcctacagcgccaaatttagcggttgtttgtacggccctttccgtgatgcagcggggtcc
tgcccatcattcggggatcgcagatgctaccagttaccacccggaggccgtggacttgct
cggcgcgctatacagagagatataggcgaaggggcagacatcataatggtaaagccggcg
agcagctacctggacattatcagagacgcaaaagaaattgccaaagacattcccattgct
gcttaccaggtcagcggtgagtatgctatgatacatgctggtgccaaggcgggcgtattt
gacttgaaatccatggcctttgaaagtactgaagggattataagggctggtgctgggatt
atagtaagctatttcgtgcctgattttctagattggctttcgaaatga

DBGET integrated database retrieval system