KEGG   Aspergillus oryzae: AOR_1_298144Help
Entry
AOR_1_298144      CDS       T01018                                 

Gene name
AO090023000173
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AOR_1_298144 (AO090023000173)
Peptidases [BR:aor01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AOR_1_298144 (AO090023000173)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1791 aa AA seqDB search
MAYTVERLEWVKRLFLKPRRSRGFPKTSDSPRYSLRERSRFSTQTVTSTWIDDDNDDNYD
PKARYTRRRKRSSRPHDVVSDTPEQQKSLVVVFPIKSDRGRAFLSSLLANHNDHGEPTSP
EIPSNEVIDGDLNHPVTRVIRTSLAHPVIFNHEPPEDGSSPCHWCDNFTYGLLGLGRRTV
EVLDFGDGRYIEIGGGQVAEGHEPSRMCVVCALERVHVIRCVAHRIVPLKGYDVDTFDLT
GAYNSLLSVTTSSTKRRKVAEPRRPGTLPGLSFASQAGRRHGHHNSDTTSTSSPPNPRLS
SDPSATQRQGSSSPPQRYIPAHLQEEVLGTSSTPDFAGSPVDLPSAACAGLSLASDPPTD
MPGSDQRDGSASPAGRDTRSSSPGVKRAAPDAEQDVEMDLAPTGKESQSDKMDTTGTEDD
DSTTNDVSGSDNVYPTPSSMSTYTAPTATRAHSKAQPSTTSERPSYDDQVAKVTCFMMQP
LKEGQKGYVVSMAWLKRVLSRSSTHADKTDKTATEGEVGPVDNSDLVLVTDPANASFKDE
KGEPFVPLRPGLQMSEDFEIVPQEGWDLIMQWYGLADQSPAIVRYAHNTSIGGESENIQY
EINPPIFTILKLSSLSGGTTPQSLKEKNMKPVRILASRHSNFQKWLKEAKTLANIDMSTK
VRVWRILGGLGSATASAAMTPAASRSASPAPAASIVANAGNNLVIDLNTFLSLSEGAQRE
LFEDAKDQTANPNYNGRMTLDLAGLGGSDVVVLEERIPGGEWVSEASKQTLNRLGVPSGS
LKNGASSKLKNKSPTASGRSSPVPEPVRGRRKDGKPRGCTGLSNLGNTCYMNSALQCVRS
VEELTYYFLNDVYKQDLNPSNPLAHNGDVAKAYANLLRMIYDEAGQSSFAPRQLKHTIGR
YGPAFSGYGQQDSQEFLLFLLDGLQEDLNRILKKPYIEKPDSTDEMVHDKAALTEFADKC
WDIYKARNDSVITDLFAGMYKSTLVCPACDKVSIIFDPFNNLTLQLPIENLWGKEVFYFG
LQKKPVRFDVEIDKNSSVKSLKELVAKKQGTDPERLIMAEIFKRKFYRMFDNTSFIAECQ
ISGNDEIAFFEVESVPTNYNPDKPQKSYFSFSRSDQEEIPSIDSPKADRILVPIFNRVER
SKSKRDLFGVPSYIVVTREEAYDFDAIYGKVLGRAATMTTRDFLNEEVLGEEQQEATQED
SDTVVMNDDDAQSADSKIKTSSVDGEDGMVDVSMRDADSASQNGAPLSGSSIPARFRDLF
ELKIMKGNEPVPLGWSSVEDNKEYPKMSFRIKTKPVTPPEESDETSDPADSKAAESGSAS
GSDADNSAEVSRTPAPVARVQIRPLVRPGEGLVVDWNEDVYDALFGGSKKDRDPLRGIPT
WQDVERVNDPELNKRRQLRQTRKKRGVSLEECLDEFNKEEILSENDAWYCPRCKEHRRAS
KKFQLWRTPDILVMHLKRFSASRGFRDKLDVLVDFPVEGLDMSGRVEAPEEGKSLVYDLF
AVDNHYGGLGGGHYTAYAKNFFTGQWNEYNDSSVSRPIDPQSVVTSAAYLLFYRRRSDRP
LGGKILEEITESSTRPVSEAGSPSESRGQSPSGDGRRLGGSSRNGSSSVLTGVGAAHQEG
DGGSRTGTQAKNRDETAPPGYTNSPTSGEKSVGKEHRLEGMSFDEAEFGDGAQSDPFRFP
SPPSWSFNRVPDAHGRSQMTTALPGSTSDDDDLLDDDASNQAVGGGDFSDSDLRLASLAD
SPGGHGAVYPGTPMEETPIQDIPPPLDADDDDDELPVVELRVNEEDRIVPE
NT seq 5376 nt NT seq  +upstreamnt  +downstreamnt
atggcatacaccgtcgagcgactagagtgggtcaagaggctctttctcaaacccagacga
tctcgcgggttcccaaagaccagtgacagccccaggtactctctgcgcgagcgatcccgc
ttcagtacgcagacggtcacctcaacctggattgatgatgataatgacgataactatgat
ccgaaggccagatataccaggaggcgaaagcgttcatcccgaccacatgacgtggtttca
gatacaccagagcaacagaagagtctcgtcgttgttttccccatcaaatccgatagggga
agagcatttctttcctcacttcttgcgaaccacaatgatcacggagagccaacttcgcct
gagataccatcaaatgaagttattgacggcgatttaaaccaccccgtcacccgcgttatt
cgcacctccttggcgcatccggtaatctttaaccatgagccgccggaggatggatctagc
ccgtgtcactggtgcgacaacttcacatatggactgctgggtttgggcagacgaacagtc
gaggtgttggattttggcgatggaagatacatcgagattggtggtggtcaagttgctgaa
ggtcacgagccgagtcgtatgtgcgttgtttgcgcgcttgaacgtgttcatgtcatacga
tgtgtagctcatcgaattgtcccgctcaaaggatatgatgtcgacacatttgatctgacg
ggtgcgtacaatagcttgctctccgtcacgacgtcttccacaaagcgccgtaaggtagca
gagcctcgcagaccaggaacccttccgggtttgtcgtttgcctcgcaggccggaagacgt
cacggacaccacaactccgatacaacctccacgtcctcgccaccaaaccctcgtctgtcc
tccgatcctagtgcgacccaacgccaaggctcttcctctcctccgcaacgttatatcccc
gcccatttgcaggaggaagtgcttgggaccagttctaccccggatttcgctggtagcccc
gtcgacctcccttccgctgcttgcgctggactctccctcgccagcgatccgcccacagat
atgcctggctccgatcagcgagatggtagtgcttcgcccgctgggcgtgacacccgctca
tcctcccccggtgtgaagcgggcggctcccgacgccgaacaagatgtggaaatggatttg
gctccgaccgggaaggagtcccagtcggataaaatggatacaaccggaacggaggacgac
gattctactacgaacgatgtttccggatctgacaacgtctatcccaccccttccagcatg
tcaacttacaccgcccctactgcgaccagggcccattccaaggcccagccttctaccaca
tctgagcgaccctcctacgatgaccaggtcgcgaaagtaacgtgtttcatgatgcaaccc
ctcaaggaaggacagaaggggtatgtggtgtcaatggcatggctaaagcgggtgctctct
aggagctcaacgcatgcagacaaaacggacaagactgccacagaaggagaggttggtccg
gtggacaactctgacttggttctagttaccgatcctgcgaatgcgtccttcaaggacgaa
aagggagagcccttcgtacccttacgcccaggcttgcagatgagcgaagacttcgagatt
gttcctcaagaaggatgggatctgattatgcaatggtacggcttggcggaccagtcacca
gccattgttcgctacgcccataacaccagcattggcggggagtccgagaatatccagtat
gagattaatccgccaattttcacgatcctgaaactgtccagcctgtccgggggcactacc
cctcagtccctgaaggagaaaaacatgaagcccgtacggattttagctagcaggcattct
aacttccagaagtggctgaaggaagctaaaacactggccaacatcgatatgtcaaccaag
gtccgtgtgtggagaatcttgggcggtttgggcagtgcgacagcatccgccgcaatgacc
ccagctgcatcgcgaagcgcttcaccggcgcctgcagcctcaattgtcgctaacgccggt
aacaatctcgtgatcgatcttaatacgttcctctcgctttctgagggtgcccaacgggag
ttgtttgaggacgctaaagatcagaccgccaacccaaattacaacggtcggatgacgttg
gatcttgctggactcggcggcagcgatgtcgtggtgctcgaggaacgtatacctggtggg
gagtgggtctctgaggcgtccaagcagacacttaatcgccttggtgttccctcgggtagt
ctcaagaatggcgcttcgtctaagctgaagaacaagagccctaccgccagtggccgatcg
tctccggtaccagagccagttaggggacgacggaaagacgggaagcctcgcggctgcacg
ggtctaagcaatcttggaaatacgtgctacatgaactctgccctgcagtgcgtacgaagc
gttgaggagctgacctattacttcctaaatgatgtgtataagcaggatctcaaccctagc
aacccgctggctcacaatggtgatgtagcgaaggcgtatgccaatttgctacgtatgatc
tatgacgaggcaggccagtcctcctttgctcccaggcagctgaaacatactattggtcgc
tatggcccagcattctctgggtatggccagcaggactctcaagaattcctgctcttcctt
ctggacgggctccaggaggatctgaacaggatcctcaagaaaccctacatcgagaagccc
gactccacagacgaaatggttcatgacaaggctgcacttaccgagttcgcggacaaatgt
tgggatatttacaaagctcgcaacgattccgtcattacggacctcttcgctggcatgtac
aagtcgactcttgtttgccctgcctgcgacaaggtcagcatcatcttcgacccattcaac
aatctcaccctccaactccccatcgagaatctctggggtaaagaggtattctacttcggt
ctacaaaagaaaccagttcggtttgatgtagaaatcgacaagaattctagtgtcaaatcc
ttgaaggaactagttgctaagaagcaaggcaccgaccctgaacgcctgatcatggccgag
atcttcaagcgcaagttctacagaatgtttgataacacaagcttcatcgctgagtgccaa
atttctggaaatgatgagattgctttttttgaagtcgagtccgtgccgactaattacaac
ccggacaagcctcagaagagttacttttccttcagcaggtcggatcaggaggagatccca
agtattgactctcctaaggctgatcgcattttggtgcccattttcaaccgtgtggaacgg
tcaaagtcaaagcgggacctttttggtgtgccctcgtacatcgttgtcactcgggaggag
gcttatgacttcgatgccatctatggtaaggtgcttggtagggcggccacgatgaccacc
cgtgacttcctgaatgaggaagttctcggagaggagcagcaagaggcgacacaggaagat
tcggatactgttgttatgaacgatgacgacgcccagtccgccgattccaagatcaagaca
tcttccgtggacggcgaagatggtatggtagatgtgtccatgcgcgatgcagactccgcc
tcccagaatggtgctcctctctctggaagctcgattccagctcgcttccgagacctgttc
gaattgaagatcatgaagggtaacgagccagtgcctctcggttggtcttcggtggaagac
aataaagagtaccccaagatgtcgttccgtataaagacaaagccagtcactccaccagag
gagtctgacgagacatccgacccggcagattcaaaggctgctgagagtggatcagcttca
ggtagtgatgccgataactctgcagaagtctctcgcaccccggctccagttgctagagtt
cagattcggcccctggttcgaccaggagagggacttgttgtggactggaatgaagatgtg
tacgacgctctttttggcggtagtaagaaagaccgtgatcccctccgcggtatcccaaca
tggcaggacgttgagcgggtgaatgaccccgaactgaataagcgccgtcaactccgccaa
actcgcaagaagaggggtgtcagccttgaggagtgtctggacgaattcaacaaggaggaa
atactttccgaaaatgatgcttggtactgtccacgctgcaaggagcaccgccgagctagc
aagaagttccaactatggaggacacctgatatcctcgtcatgcacctcaagagattcagt
gccagccgcggtttccgggataagttggatgtgctcgttgacttccctgtggaaggcctc
gatatgagtggcagagtggaagctccggaagagggtaagagcttggtctatgaccttttc
gcggttgacaaccactacggtggtcttggtggtggtcactatactgcatatgccaagaac
ttttttactggccagtggaacgagtacaatgactcaagtgtctcacgacctattgacccc
caaagtgtggtcacctcggctgcctacctcctcttctaccgccgccggtccgatcgtccg
ctcggtggtaagatccttgaggaaattaccgagtcatctacccgacctgtgagtgaggct
ggttcgccgagcgaatctcgtgggcaatcaccgtcgggggacggtcggcgtctcggcggc
tcatcccgcaatgggtcgtcgagcgtcttaaccggagtcggagcagctcaccaggaggga
gatggtggttcgcgaaccggaacccaagcgaagaaccgggatgagaccgcgccccctggg
tacacaaatagtcccacttctggggaaaagagcgttggtaaagaacaccgactggaaggt
atgagttttgatgaagccgagttcggtgatggagcgcaatccgatccgttccgcttcccg
agtccgccctcgtggtctttcaaccgagtcccggatgctcacggccgttcacagatgacc
acagcgctaccggggtccacctctgatgacgatgacctgctcgacgacgatgctagcaac
caggcagttggtggaggagacttcagcgattcggacctacggctggcctctttagcggac
agccccggaggtcacggagcggtatacccggggaccccgatggaggagacaccaattcag
gatatccctcctccattggatgcagatgacgacgacgacgagctacccgtagtggagcta
cgagtgaacgaggaagaccggatagtgcctgagtag

DBGET integrated database retrieval system