KEGG   Aspergillus oryzae: AOR_1_304194Help
Entry
AOR_1_304194      CDS       T01018                                 

Gene name
AO090012000173
Definition
lysophospholipase NTE1
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
aor  Aspergillus oryzae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AOR_1_304194 (AO090012000173)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AOR_1_304194 (AO090012000173)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1523 aa AA seqDB search
MATDGGPLAASSASLDSSLSPLHASPSPSSTYTASSLALSAPAIAASFSVASTFSNSLIP
PPPLPPPTPSTMAGWFGWVFSFFFQVIPSVLYWVITFATITLPTWLFTLFSMSLTFTMNF
TTLLLIALAIVSTISWFIRYRFLNMYSRLPSEPQRKEPHLDLFPDVQEGDSKPGLANYLD
EFLSAIKVFGYLERPVFHELTRTMQTRKLIAGETLMLEEEKGFCLVVDGLVQIFVKSMRD
GKPNVDEGSNHMGAESSDEDDHRVDGKQGYQLLTEVKNGASMSSLFSILSLFTEDIQLRA
SEGSSSSASSVGPSTNARVSDSFPASPHGLEDSPRSNFVRDHGDSVAHISNSNGELLPSV
PPLNLGESHAMPIQEPYPKPRSQPGKRRRKSVHPDIVARAMVDTTIAIIPASAFRRLTRV
YPRATAHIVQVILTRLQRVTFATAHSYLGLNNDVLGIEKQMTKFTTQDLPNEMRGAALDR
LKDKFIKERDRLGPEEIIKGIALHNPFAGRRRRSSSFLRKEAVLHAKMAAQSKRPVSMAS
PEDISGDRESAGPSPGDLLSTIQLSRFGPRYEHLAPKLLSPLTDKENPPFMAPVMHSSPF
HRKKDAVDEDALFRESILDCIMNGIGLTSSTRDVLRKSSHTSGDISPKLLSYDSRRQKAV
FTNNAFGFIDPYDSSADGETESMMSMSMTSAGGTSPIVNLREELRNDIEIVYFPQGSVLV
EQGERHPGLYYVIDGFLDVGIPVSDKGEDLVGGSRPVYGQPPEEFFPTLKRTTTSSSRVS
GVTSATNDTKRKRQSRKSLYLIKPGGIQGYVGSVASYRSYTDVVAKTDVYVGFLPRSSLE
RIAERYPIALLTLAKRLTSLLPRLLLHIDFALEWVQVSAGQVIYHQGDESDAIYLVLNGR
LRSVLEGTDGKITVVGEYGQGESVGELEVMTESTRPATLHAIRDTELAKFPRSLFNSLAQ
EHPGITIQVSKLIAQRMRDLVELPMPEKGGEHANVGSVKTAASVVNLRTVGILPNALHQI
GVTNGVTSLNQAAILNHLGRHAFSKMGKLKLSQYLADLEEKYGMVLYIADTNVNSPWTQT
CITQADCILLVGLAESSPSIGEYERFLLGMKTTARKELVLLHSERYCPPGLTRQWLKNRM
WINGGHHHIQMGFRLTPEPSHPQAKRLGAVLKQRVQVIQAEIQKYTSRRIRQTPLYSAQT
PFKGDFHRLARRLCGRSVGLVLGGGGARGIAQVGVIKALEEAGIPIDIIGGTSIGSFIGA
LYARDADVVPMYGRAKKFAGRMASMWRFMLDLTYPTTSYTTGHEFNRGIFKTFGDSQIED
FWLEYYCNTTNISKSRPEFHSSGYTWRYVRASMSLAGLIPPICDEGSMLLDGGYIDNLTV
THMKGLGADVIFAVDVGSIDDNTPQGYGDSLSGFWTVLNRWNPFSACPNPPTLSEIQARL
AYVSSIDNLERAKNTPGCLYMRPPIDPYGTLEFGKFDEIYQVGYAYGKQYLEKLRSEGSL
PLPEETEEKKKLQRTLAPRRASI
NT seq 4572 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgacggtggtcccctcgcggcctcgtctgcgtctctcgattcaagtctaagc
cctcttcatgcatctccctcaccctcctcaacctacactgcttcgtccctcgccctatct
gctcccgccatagccgcaagcttttccgtggcttcgaccttttcaaattctcttatccca
cccccaccgttaccccctcctacgccttcaaccatggcggggtggttcggatgggtgttt
tctttctttttccaggtcattccaagcgtcctatactgggtgataacgtttgcgaccatc
acgctgcccacatggctattcacgctcttctcaatgagcttgaccttcactatgaatttc
accactctcttgttgatcgcgctggcgatcgtatcaacgatcagttggtttatccgttat
cggttcttgaatatgtatagtcgtctgccttcggaaccccagcgcaaagaaccccatctc
gatctcttccccgatgtccaggaaggggactccaaaccgggcctggccaattacctagac
gaatttctaagcgccatcaaggtgtttggttacctcgaacggcctgtatttcatgaattg
acacgtaccatgcaaacgaggaagttgattgctggggaaaccttgatgctggaggaagag
aaaggcttctgtcttgtggtggatggcttggtccagatattcgtcaagtccatgcgggac
gggaaaccaaatgtagacgaaggttcaaaccacatgggagccgagtcttctgatgaggac
gatcatcgtgtggacggaaagcaaggttatcaactgctcacagaagtcaagaacggtgcc
tccatgtcgtccttgttctccatcctgtccttgttcaccgaggatatccaactacgagcc
agcgaaggctcgtcgtctagtgcatccagtgtaggccctagcaccaatgctcgggtatct
gactcgtttccagcgagccctcacggcttagaggacagtcctcgttctaatttcgttaga
gatcatggtgactccgtcgcccatataagcaacagtaatggggagcttctgccatccgtc
ccgcccctaaacctaggagaaagccatgctatgcccatccaggagccttacccgaaacca
aggagccagccaggcaagaggcggcgcaagtcagtccatccagatattgtggctcgagcc
atggtggacacgaccattgccatcatcccggccagcgccttccgccgtctgacgagggtc
tatccgagagcgaccgcccatattgtccaggtgatcctgacacggctccaaagagtaacg
ttcgccacggcacattcttatctaggtctcaacaatgatgtactgggcattgaaaaacag
atgaccaagttcacgactcaggatctacccaatgaaatgcgtggggccgcgttagatcgc
ctcaaggacaaatttattaaagagcgagaccgcctgggcccggaagagatcatcaagggc
atcgcacttcacaatccttttgctggcagaaggcgccgatccagtagcttcctgaggaaa
gaagcagttctccatgcaaagatggcagcacaatcgaagcgaccagtgagcatggccagc
ccagaggatatctccggtgaccgtgagtcggcagggcctagccccggggatctgttgtct
accattcaactctcccggtttggccctcgatacgagcacttagctccgaaactgctcagc
ccattaacagataaagagaatcccccctttatggctcctgttatgcacagttcgcctttt
catcgaaagaaggacgctgttgacgaggatgccctgttcagagaatccatactggattgc
atcatgaatggcattggactcactagcagcactcgcgatgtcttacgtaagagcagtcac
acctctggggacatatccccaaagctactttcatacgattctcggcggcaaaaggccgtg
ttcactaataatgcattcggcttcatcgacccttacgatagttctgcggatggtgagacg
gaatcaatgatgtcaatgtccatgaccagcgctggtgggacatcgcctatcgtcaatctg
cgagaagagcttcgaaatgacatcgagatcgtctatttcccccagggttcagtgctggtg
gagcagggggaacgccatccaggcctgtactatgtgatcgacggattcctagacgtaggt
atccctgtatccgacaaaggagaagatcttgtgggcggctcgagaccggtatatggccag
ccacctgaggaattctttccgaccttgaagcggacgacgaccagctcctctcgagtttcg
ggtgtgacgagtgccacaaatgatactaagcggaaaaggcagtcgcgaaagtcactctat
cttatcaagcctggtggtattcaaggatacgtcggatccgttgcatcttacaggtcctat
acggacgtggtggcgaaaacagatgtgtatgtcgggttccttccaaggtcatccttggaa
agaatcgccgagcgttaccctattgcgctgttaaccctggcaaagcgattgacaagtctt
cttcctcgtttgcttcttcacatcgacttcgccctagaatgggtgcaagtaagtgcaggc
caagtcatctatcaccagggggatgagagtgatgcaatctatcttgttttaaatgggcgt
ctacggtctgttctcgaaggtacagatggcaagattacagttgttggcgaatatggtcag
ggagaaagcgttggggagctagaggtcatgacagagtcgacacgcccggcaactctacac
gccattcgggatactgagctagctaaattcccgcggtcccttttcaacagtcttgcccag
gaacacccgggaattactatccaggtttctaagctcattgcccagcggatgcgagatctc
gtcgagcttcccatgcctgagaagggaggtgagcatgccaacgttggaagcgtcaagacc
gctgcctctgtggtaaacctccgtactgttggtatacttcccaacgcgcttcaccagatc
ggcgtgacgaacggcgttacctccctcaaccaagcggcgatcttgaaccatctcggacga
catgctttcagcaagatggggaaattgaagttgtcccagtatctggccgacctcgaagaa
aagtatgggatggtactctatatcgcagacaccaatgtgaactctccatggacacagacc
tgcatcacgcaagccgactgcattctgctcgttggccttgccgagtcatcgcctagtatc
ggtgagtacgaaagatttctacttgggatgaagacaacggctagaaaagaacttgtgttg
ctacattccgagcggtactgccctcccggactgacgcgccaatggctaaagaaccggatg
tggatcaacggtggccaccatcatattcagatgggcttccgcttaacccctgagccctca
catccgcaggcgaaacggcttggagctgtactgaaacaacgtgttcaagttatccaggca
gaaatccaaaaatacacctcgcggcggattcgccagacgcctctctactcggcacaaact
ccgttcaagggcgacttccatcgcctggctcgccgactttgtggcaggtctgttggactc
gttcttggtggcggaggagctcggggtatcgcccaagttggcgtcatcaaagcactggaa
gaggccgggatccctatcgacatcattggtggtacatctatcggctcattcattggagct
ttgtatgcacgggatgcggatgtggttcccatgtatggtcgagcgaagaagtttgccggt
cgcatggcgagcatgtggcggtttatgctggatctaacgtatcctaccacctcttacacc
actggccatgagttcaaccggggaatcttcaagacgtttggagatagccaaatcgaggac
ttttggctggagtactactgcaacaccaccaacatcagcaaatcacggcctgaattccac
tcgtcgggttatacttggcgctacgtgcgtgcatcgatgtcattggccggcctaattccc
ccgatttgcgacgagggcagcatgctacttgacggcgggtacatcgacaaccttacagtg
acccacatgaagggactcggggccgatgtgatttttgccgtcgatgtgggctcaatcgat
gacaacacgcctcaagggtacggtgattcgctgtccgggttctggaccgtgctcaaccgt
tggaacccgttctccgcttgccccaaccctcccacgctgtccgaaatccaagcacgactc
gcatacgtgtcatcgatcgacaatctagaacgggctaaaaacaccccaggctgtctgtat
atgcgtcctcccattgacccatacggaacccttgagttcggcaagttcgatgagatctac
caggtaggctacgcatatggcaagcagtatctagagaaactgcgcagtgaaggatccctg
ccgttaccggaggagacagaagagaaaaagaagctacaacgtaccttggcgcctcggcga
gcaagtatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system