KEGG   Aspergillus oryzae: AOR_1_3088174Help
Entry
AOR_1_3088174     CDS       T01018                                 

Gene name
AO090005000639
Definition
N-acetylglucosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aor  Aspergillus oryzae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AOR_1_3088174 (AO090005000639)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    AOR_1_3088174 (AO090005000639)
   00603 Glycosphingolipid biosynthesis - globo series
    AOR_1_3088174 (AO090005000639)
   00604 Glycosphingolipid biosynthesis - ganglio series
    AOR_1_3088174 (AO090005000639)
   00511 Other glycan degradation
    AOR_1_3088174 (AO090005000639)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AOR_1_3088174 (AO090005000639)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 600 aa AA seqDB search
MRISQICTVLSTVTSAVAVGVNPLPAPREISWGSSGPKSIAGELQLRTDSDSADGIVADA
WNRAWETIVALRWVPAATEAPISSFEPFPTPTAGASKKSKRASNSLQYVNVQVKDIEADL
QHGVDESYTLDVEEDSDTITINAETVWGALHAFTTLQQLVISDGHGGLIIEEPVNIKDSP
LYPYRGIMLDTGRNFVSLPKIFEQLEGMSLSKLNVLHWHIDDAQSWPIWVDVYPEMVKDA
YSPHEIYSRNDVRNIVNYARARGIRVIPEIDMPSHSSSGWKQVDPEMVTCTDSWWSNDDW
PLHTAVEPNPGQLDIIYNKTYEVVGNVYKELSDIFPDHWFHVGGDEIQPNCFNFSTHVTK
WFAEDPSRTYHDLAQYWVDHAVPIFQNYSQERRLVMWEDIALSADNAHDVPKNIVMQSWN
NGLEYISNLTARGYDVIVSSSDFLYLDCGHGGFVTNDPRYNVMANPDANTPNFNYGGNGG
SWCAPYKTWQRIYDYDFTLNLTETQAKHIIGATAPLWGEQVDDINVSSMFWPRAAALAEL
VWSGNRDANGNKRTTEMTQRILNFREYLVANGVQAQALVPKYCLQHPHACDLYRNQAAIQ
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgcggatttcccagatctgcaccgtgctctccacggtaacctcagccgtcgctgttggt
gtaaatcccttgccggcgccgcgcgagatctcctggggttcctccggtcccaagtccatc
gccggagagctgcagctgcgcaccgactctgactcggctgacgggattgtggccgatgca
tggaatcgtgcatgggagaccatagtcgccttgcgatgggtccccgctgctacggaagct
cctatctcctccttcgaacctttcccaacccccacagcgggcgcttccaaaaagtcgaag
cgcgcctcaaattcactgcaatatgtcaacgtacaagtcaaagacattgaggccgatctt
cagcacggtgttgatgagtcttacacgctcgatgtcgaggaggattcagataccatcaca
attaatgctgagaccgtttggggtgctctgcatgcatttaccactcttcaacagctggtc
atatccgatggccatggcggtctgattatcgaagagccagtcaacatcaaagattctcca
ctttatccctaccgtggaatcatgcttgatactggtcgtaacttcgtctccctgcccaaa
atattcgaacagctggagggcatgtccctttcgaaactcaacgtcttgcactggcacata
gacgatgcgcaatcttggcctatctgggtcgacgtttatcccgagatggtcaaagatgct
tactcgccccatgagatatactcgcgcaatgatgtccgcaacattgtcaattatgctcgg
gctcgtggtattcgtgtgattcccgaaatcgacatgccaagtcactcctcgtcaggctgg
aagcaagttgaccccgaaatggttacttgcacagattcctggtggtccaatgatgactgg
ccactccataccgcggttgagccaaatccaggtcagcttgacatcatctacaacaagact
tacgaggtcgtcggcaatgtttacaaggagctgtcggacattttccctgatcattggttc
catgtcggaggagacgagatccaacctaactgcttcaatttcagtacccacgtcaccaag
tggtttgctgaggatccctcgcgcacgtaccacgacctggctcaatactgggttgatcat
gctgtgcctattttccagaactacagccaagaacgccgtctggttatgtgggaggacatt
gcgctgtccgcggataatgcacatgatgtgcccaagaacattgtaatgcagagctggaac
aatggtctagagtacatctcaaacttgaccgctagaggctacgacgtcatcgtgtcttcc
tctgactttctgtacctggactgtggtcatggaggctttgtcaccaacgatccgcggtac
aatgtgatggctaacccagatgcgaatacccctaacttcaactatgggggcaatggagga
tcgtggtgcgccccttacaaaacctggcaacgtatctacgactacgacttcactctcaac
ctcactgagacgcaagctaagcatatcattggcgcaaccgctcctctttggggcgagcaa
gttgatgatatcaacgtctctagcatgttctggcctcgtgctgcagctctggcagagcta
gtctggtccggaaaccgcgacgctaatggcaacaagcgcaccacggagatgacacagcgt
atcctcaacttccgtgaatacctcgttgcgaatggtgttcaggctcaagctctggttccg
aagtactgcttgcaacatcctcatgcttgcgatctctaccgtaaccaagccgcaattcag
taa

DBGET integrated database retrieval system