KEGG   Aspergillus oryzae: AOR_1_322184Help
Entry
AOR_1_322184      CDS       T01018                                 

Gene name
AO090009000193
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AOR_1_322184 (AO090009000193)
Peptidases [BR:aor01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AOR_1_322184 (AO090009000193)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1285 aa AA seqDB search
MTSFQRSGKTAPRLVQDIYEYDPAHPPATGRNLLADVPPVFPEYYNGPLEHISSAACRHN
FVSKPAQSYVPQSEQGNTGASTKVSAVCLMCRYHLQVEVSSTPGIGQPSTRFSDHVHHLV
YKSGKHRGGAAPEEVSPKGQMLEMFHYECSYLSCSVAVSLRFASPVLNDDRVRLLTDPEV
LRQRANEAFAAHPDRLEGVAPPTPINVLLNLRTYISNALLDSQQSKSISAVNKRFMTCFG
VEGKPCKDLLEFLGFSSKNEGFWEPPRPNPWAEFPYRDQLKIFLDDVIHELTALIEQRPV
VEKKGHQLEFIRQPVFNDLLYALGSLDYPKASRSSEFQMAPQPYYEDLGVVEDMAASSII
EAFNRQVSVDPARTPVYLKCLKSIGILRGGEDGSLIDQAVQVAYSEGKYTEEDVVDAYKY
FGLSHDDQRLTEESIIGKFYAYLGATTAVQETETRRQLWRIGDSRRSERIKAAAEERVST
AEQARVFLGVSADTPDDFVMAVYTAKVNDNPSSRDLARRAVQLLAEERKSEALKHFLKTG
EMTAGEMDVADAYRLLQIPDRTVDEGAIMAAYTICVDEAPAQAENYNQALRIIAKDKNSP
LLSNMVSGSTTKPDRNLAEWPVGLQNIGNTCYLNSLLQFYFSIRPYRDMVLDFEKFKMEI
NEDMLGQKQVGSRKVSQKEVEQSQRFLSELRTLFNDMITAPATYVIPTQELARLTLISPS
NEAAIRRRSTLSGIRPSALGEINGVPVMGPLGPPQLTPESEVKGPIAPEPEKPQRSTTSD
VDSEATLVSDGARIDATVPSSNDKEPEPLVTDPTKMDVQDVLTPEAVEYQPSDKPTSGEQ
NELSSQPPPVPPRPGPQPDPQKQLIEEVEIGAQQDVTEVINNVLFQSQCAIKPISLAPDG
EQLDQVKDLFYGKAKSYIQTTEGVRSKEEWWCDIKIDVATGSRDIYAAIDGAFDVQKVSV
GNSVAEQFSAISKLPPVLQVQVQRVQFDPVKKRSFKSTHHLELKETIYLDRYMDTQQPEI
LNRRRQCWEWKNALRTLEARRAELQRQSEADGLDIPSLFDNAKDVLEELNSMKEDPEIAA
DAVPINSELIPELNQLSQIARAELNYIEQEIKDLQIMISSQFADYKHLAYRLYAVFVHHG
SVEFGHYYIYICDFERNIWRKYNDNYVTEVHDLDEIFTSQDRQNPPTPYFLVYVNATMKD
RLVSPLCREILESPPEDQLSGDGGIATEGVTPPTVAEDVDMNPPAYDEIWADKGTSGSET
TLPTGVASLNPLKRKGLDDIAGSTS
NT seq 3858 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcctttcaacggtcaggcaagaccgccccccgtcttgtacaagatatatacgaa
tatgatcctgctcaccctccagcgaccggccgcaatctgctcgcggacgtcccgccagtg
tttcctgaatattacaatggaccgctagaacatatctcatcggcggcatgccgccataat
tttgtatcgaaaccagcacagagttatgtccctcagtcggaacaaggcaacactggagcc
tctacaaaggtgtcggctgtgtgcttgatgtgccgctatcatctgcaagttgaggtgagc
tctacgcccggtattggtcaacctagcacgagattttcagaccacgtacatcatctggta
tataagtccggaaagcacagaggcggcgcagcgccggaggaggtcagtcccaagggacag
atgctggagatgttccattatgaatgttcatatttgtcttgctccgtcgcagtatctttg
cggttcgcctcacctgtgcttaatgatgaccgggtgcgactgttgacagaccccgaagtg
ctgcgacagcgggcgaacgaggcatttgcagcccatcctgaccgtctggaaggagttgct
ccacccacacctatcaatgtcttgctgaacctgcgtacatatatcagcaacgctcttctt
gatagccaacaaagcaagtcaatctcagcagttaataaaagatttatgacgtgtttcgga
gttgaagggaagccttgcaaagacctgttagaattcctgggatttagctctaagaacgaa
ggcttttgggaacctcctcgaccgaatccgtgggcagagtttccctatcgcgatcaactc
aagatatttctcgatgacgttatacacgaacttacagcgctcatcgaacagaggccagtg
gtagagaagaagggccaccagctagaatttattcgtcaaccggtcttcaacgatcttctc
tatgcactgggatctttggactacccgaaggcctcacgatcaagtgaatttcagatggct
cctcaaccttactacgaagacctgggtgttgtcgaggacatggcggcttcatcaatcata
gaggcttttaaccgacaagtctcggtggatcctgctaggactcctgtctacttgaagtgt
ctgaagtcaatcgggattctcagaggaggagaagatggttctcttatagaccaggcagtt
caggtagcctactccgaagggaaatataccgaagaggacgtggttgatgcctacaagtac
tttggcctaagtcacgacgatcagcgactcacggaagaaagcatcattgggaaattctat
gcttatctaggtgccactactgctgttcaggagactgagacccgcagacaactatggagg
ataggagatagcaggcggagtgagcggatcaaggcagcagcggaagaaagggtgtcaact
gctgagcaggcccgggttttccttggcgtcagcgctgatacgcctgatgattttgttatg
gcagtttacacagctaaagtcaatgacaacccatcgagccgggatcttgctcgccgtgca
gtccagctgctagcagaagagcgaaaatcggaagccttgaaacattttctcaagacaggc
gaaatgactgccggtgagatggacgttgctgatgcctaccgtctccttcagatacccgac
cgcaccgtggatgagggagcaatcatggcagcatacactatctgtgtggatgaagctcca
gcacaagctgagaactacaatcaggcgttgcggattatcgcgaaagataagaatagccct
ctgctgagcaatatggtttctggttctaccactaaacctgaccgtaacttggctgaatgg
ccagttggactgcagaatattggcaatacctgctacctcaacagtctgttgcaattctat
ttttcaattcgtccataccgtgatatggtcttggacttcgagaaattcaaaatggagata
aatgaggacatgttgggccaaaaacaggtggggtctcgcaaggtttcgcaaaaggaggtt
gagcagtcccaacgtttccttagcgagttgcgaactcttttcaatgacatgatcactgcc
ccagcaacttacgttattcccacccaggagctggcgcggttgacgctgatcagcccgtct
aacgaagccgctattcgtcgccggtcgacgctgtctggaatcagacctagtgctctcggt
gaaatcaacggtgtgccagttatgggacctctcgggcccccacagctgactccggaaagt
gaagtcaaggggcccatagctcccgagccagagaaaccccaacgttcaacgacaagcgat
gttgatagcgaggcaactcttgtttctgatggcgccaggatcgatgccacagtcccgtct
tctaatgacaaggaacccgagcctctagttacagatcctacaaagatggacgtgcaggac
gtgttaacccctgaggcagttgagtaccaaccatccgacaaaccgacttctggtgagcag
aatgagttgtctagccagcctcctccagttcctccacggcctggtcctcaacctgacccg
cagaagcaacttatagaggaagtagagattggagctcagcaggatgtgacagaagtaatc
aataatgtcctgttccagagtcaatgtgccatcaagccaatttcgcttgctccagacggt
gagcagctcgatcaggtgaaagacttgttttacggcaaagccaagtcctacatccaaaca
actgaaggagtgcgatcaaaggaagaatggtggtgtgatataaagatcgacgtcgccact
ggatcacgagatatctatgctgccattgacggtgcttttgacgtccagaaagttagcgta
ggtaattcggtggcggaacagtttagtgcaatcagcaagctgccgccagttctccaggtt
caggtccagcgtgtccagttcgatcctgtcaagaagcgctccttcaagtccacccaccat
ttagaattgaaggagactatctaccttgatcggtatatggacacccaacaacccgaaatt
ttgaatcgccgtcgtcagtgttgggaatggaaaaatgcattaagaacgctcgaggctcgt
cgagcagagttgcaacgccaaagtgaagctgatggcctggacataccgagcttgttcgac
aatgccaaggatgttctagaagagctgaactctatgaaggaggaccccgagatcgcagca
gatgcggttcctatcaattcagaacttatacctgagcttaatcaactttcccagatagcg
agggcagagctgaactacattgagcaggagatcaaggatctacaaattatgatctcaagc
cagtttgctgactacaaacatttggcctatcgtctctatgctgtcttcgttcatcatggc
tccgttgaattcgggcactactacatttacatctgtgatttcgaacggaatatttggcgg
aaatataacgacaactatgtcactgaagtgcacgacctggatgaaatattcacgagccag
gaccgccaaaatcccccgactccgtacttcttagtatacgtcaatgcgactatgaaggac
cgtctagtcagtcctctttgcagggagatactcgagtctcccccagaggatcaactgagc
ggggatggaggaattgctacggagggagttactccgccgacggttgcagaagatgtggac
atgaacccaccggcatacgatgagatatgggctgacaaaggcacatcaggctctgaaaca
acacttccgaccggagtcgcatcactgaatccattgaaacgaaaagggttagatgatata
gctggctcaactagctaa

DBGET integrated database retrieval system