KEGG   Aspergillus oryzae: AOR_1_332184Help
Entry
AOR_1_332184      CDS       T01018                                 

Gene name
AO090009000199
Definition
mitogen-activated protein kinase spm1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
aor  Aspergillus oryzae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:aor00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AOR_1_332184 (AO090009000199)
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AOR_1_332184 (AO090009000199)
Protein kinases [BR:aor01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   AOR_1_332184 (AO090009000199)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MADLRGRKIFKVFNQDFIVDERYNVTKELGQGAYGIVCAATNIQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKIPFQRLFPSANPDALDLLDRMLAFDPS
SRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVDDVQEMRRMIYEEVVRFRAAVRQ
QSQAQAAAAAQQQQIAQQTNVPIPENQQGVWKQEEPKPQEALAAGGGVHNDLESSLQRGM
DVQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctacgaggacgtaagatcttcaaggtcttcaaccaggattttattgtggat
gaacgatacaatgtcacgaaggagttgggtcaaggtgcatatggtattgtctgtgccgcc
acgaacatccagaccggcgaaggtgtcgccatcaagaaagtcaccaatgtcttcagcaag
aagatcttagccaagcgcgccttaagagaaattaagttgcttcagcatttccgaggccac
cgtaatatcacttgtctgtatgacatggacatcccgcgcccagataacttcaatgaaaca
tatctgtatgaggagttgatggagtgtgatctcgccgctattatccgttccggacaacct
ttgaccgatgcccacttccagtcttttatttatcagattttgtgtggtctgaagtatatc
cactcggccaatgtattgcatagagatttgaaacccggaaacttgctggtcaatgccgat
tgtgaactcaagatttgcgatttcggattggcgcgtggtttctcgattgacccggaagag
aacgcaggttacatgaccgaatatgtcgcgacaagatggtaccgtgctccggaaatcatg
ttgagcttccagagttacactaaagctatcgatgtgtggtccgtgggttgcatcttggct
gaacttcttggcggccgccccttcttcaagggtcgtgactatgtcgaccagctcaaccag
attctgcactacctgggcactccgaacgaggagaccttgagccggatcggctctccacgg
gcccaggagtacgtacgcaacttgcctttcatgcccaagatccccttccagcgcttgttc
cccagtgccaaccctgatgcgcttgacttgctcgaccgcatgctggccttcgacccctcg
tcgcgtatctcggttgaagaggccctggagcacccatacctgcacatctggcacgacgca
tcggacgagccgacgtgccccacaaccttcgatttccacttcgaagtggtggacgacgta
caggagatgcgtcgtatgatctacgaggaagtcgtgcgcttccgtgccgccgtccggcag
cagtctcaggcgcaggccgccgctgccgcccaacagcagcagattgcccagcagaccaac
gtcccgatccccgagaaccagcagggcgtttggaagcaagaggagcccaagcctcaagag
gcgctcgccgcgggcggtggcgtccacaacgatctggaatcgtcgctgcagcgtggaatg
gacgtacaataa

DBGET integrated database retrieval system