KEGG   Aspergillus oryzae: AOR_1_332184Help
Entry
AOR_1_332184      CDS       T01018                                 

Gene name
AO090009000199
Definition
mitogen-activated protein kinase spm1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
aor  Aspergillus oryzae
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:aor04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MADLRGRKIFKVFNQDFIVDERYNVTKELGQGAYGIVCAATNIQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKIPFQRLFPSANPDALDLLDRMLAFDPS
SRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVDDVQEMRRMIYEEVVRFRAAVRQ
QSQAQAAAAAQQQQIAQQTNVPIPENQQGVWKQEEPKPQEALAAGGGVHNDLESSLQRGM
DVQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctacgaggacgtaagatcttcaaggtcttcaaccaggattttattgtggat
gaacgatacaatgtcacgaaggagttgggtcaaggtgcatatggtattgtctgtgccgcc
acgaacatccagaccggcgaaggtgtcgccatcaagaaagtcaccaatgtcttcagcaag
aagatcttagccaagcgcgccttaagagaaattaagttgcttcagcatttccgaggccac
cgtaatatcacttgtctgtatgacatggacatcccgcgcccagataacttcaatgaaaca
tatctgtatgaggagttgatggagtgtgatctcgccgctattatccgttccggacaacct
ttgaccgatgcccacttccagtcttttatttatcagattttgtgtggtctgaagtatatc
cactcggccaatgtattgcatagagatttgaaacccggaaacttgctggtcaatgccgat
tgtgaactcaagatttgcgatttcggattggcgcgtggtttctcgattgacccggaagag
aacgcaggttacatgaccgaatatgtcgcgacaagatggtaccgtgctccggaaatcatg
ttgagcttccagagttacactaaagctatcgatgtgtggtccgtgggttgcatcttggct
gaacttcttggcggccgccccttcttcaagggtcgtgactatgtcgaccagctcaaccag
attctgcactacctgggcactccgaacgaggagaccttgagccggatcggctctccacgg
gcccaggagtacgtacgcaacttgcctttcatgcccaagatccccttccagcgcttgttc
cccagtgccaaccctgatgcgcttgacttgctcgaccgcatgctggccttcgacccctcg
tcgcgtatctcggttgaagaggccctggagcacccatacctgcacatctggcacgacgca
tcggacgagccgacgtgccccacaaccttcgatttccacttcgaagtggtggacgacgta
caggagatgcgtcgtatgatctacgaggaagtcgtgcgcttccgtgccgccgtccggcag
cagtctcaggcgcaggccgccgctgccgcccaacagcagcagattgcccagcagaccaac
gtcccgatccccgagaaccagcagggcgtttggaagcaagaggagcccaagcctcaagag
gcgctcgccgcgggcggtggcgtccacaacgatctggaatcgtcgctgcagcgtggaatg
gacgtacaataa

DBGET integrated database retrieval system