KEGG   Aspergillus oryzae: AOR_1_360094Help
Entry
AOR_1_360094      CDS       T01018                                 

Gene name
AO090120000207
Definition
serine/threonine-protein kinase PRKX
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
aor  Aspergillus oryzae
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:aor04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 396 aa AA seqDB search
MATGTVDPSAPKDVQGTSAPAGDIDTGSGNLHEKEKQMVSAIRPPHQRHLSPFVITERPE
EKQLGVSTRTLTVDDFALLKTLGTGTFARVWLVRLKDEIRQRDKVYALKILRKADVIKLK
QVEHVRNERKTLSAVAGHPFITTLIASFSDDQSLYMLLDYCPGGEIFSYLRRARRFNENT
AKFYAAEITLTIEFLHDVEGIVYRDLKPENILLDAEGHIRLVDFGFAKKVDNRETYTLCG
TPEYLAPEVIHNSGHGLAVDWWALGILIYEFLVGQPPFWDQNPMRIYEQIVEGRIRFPQN
MSPAAQNIISLLCKTNPTERLGYISGGSARVKSHPFFEDIQWDDLFYRRIKGPIIPRVDH
PADTGNFEEYPDPDVRSQNVYTDDLKKKYEALFSDF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctacaggaacggtcgacccttcggcccctaaggatgtccaggggacctcggccccg
gccggagacatcgatacggggtcaggtaatcttcacgagaaagaaaaacaaatggtgtct
gctatccgcccgccgcaccagcgacatctgagtcctttcgtcatcaccgagcggccggag
gaaaagcaactgggtgtgtctacccgcaccttgacagttgatgactttgcccttttgaaa
accctcggtactggcactttcgctcgagtatggctagtgagattgaaggacgaaatacgt
cagagagataaagtgtatgcactcaaaatactacggaaggcggatgtgatcaaattgaag
caggtcgaacatgtgcgcaatgagcggaagactctctcggcggttgccggccaccctttc
ataacgacactgatagcctcattttccgacgaccaaagtctgtacatgttgttggactat
tgccctggcggtgagatctttagttacctacggcgcgcgcgccggttcaacgaaaatacc
gctaaattctatgcggccgagataactcttaccatcgaattcctccacgatgtagaggga
atcgtttatcgcgacctgaagcctgaaaacattcttctggacgccgaggggcacattagg
cttgttgactttggctttgcaaagaaagtcgataatcgggagacatataccctttgcggc
acgccagagtaccttgcccctgaggtcatccataacagtggccatggccttgcagtggac
tggtgggccctaggtattctcatttacgagtttctcgtggggcaaccgcccttctgggac
cagaatcccatgcgtatatacgaacagatcgttgaaggccgcatacgcttccctcagaat
atgtcgccggcggctcagaatataatatccttactttgcaagaccaatccgacggagcgc
ctagggtacatatctggagggtctgccagagtcaagtcacatccattctttgaagatata
caatgggatgatctgttttaccgccgtatcaaagggcccatcatcccgagagtcgaccac
cccgcagacaccggtaacttcgaagagtatcccgatccggatgtgagaagtcaaaacgtt
tataccgatgatctgaagaaaaagtatgaggctttgtttagcgacttttag

DBGET integrated database retrieval system